Chlamydomonas Molecular Genetics and Physiology

Microbiology Monographs

Series Editor: Alexander Steinbüchel

Michael Hippler Editor

Chlamydomonas:
Molecular
Genetics and
Physiology
Volume 30
Series editor
Alexander Steinbüchel
Münster, Germany
More information about this series at http://www.springer.com/series/7171
Michael Hippler
Editor
Chlamydomonas: Molecular
Genetics and Physiology
Editor
Michael Hippler
Institute of Plant Biology and Biotechnology
Universität Münster
Münster, Germany
ISSN 1862-5576 ISSN 1862-5584 (electronic)

ISBN 978-3-319-66363-0 ISBN 978-3-319-66365-4 (eBook)
DOI 10.1007/978-3-319-66365-4
Library of Congress Control Number: 2017958132
© Springer International Publishing AG 2017

This work is subject to copyright. All rights are reserved by the Publisher, whether the whole or part of
the material is concerned, specifically the rights of translation, reprinting, reuse of illustrations,
recitation, broadcasting, reproduction on microfilms or in any other physical way, and transmission
or information storage and retrieval, electronic adaptation, computer software, or by similar or
dissimilar methodology now known or hereafter developed.
The use of general descriptive names, registered names, trademarks, service marks, etc. in this
publication does not imply, even in the absence of a specific statement, that such names are exempt
from the relevant protective laws and regulations and therefore free for general use.
The publisher, the authors and the editors are safe to assume that the advice and information in this
book are believed to be true and accurate at the date of publication. Neither the publisher nor the
authors or the editors give a warranty, express or implied, with respect to the material contained
herein or for any errors or omissions that may have been made. The publisher remains neutral with
regard to jurisdictional claims in published maps and institutional affiliations.
Printed on acid-free paper
This Springer imprint is published by Springer Nature

The registered company is Springer International Publishing AG
The registered company address is: Gewerbestrasse 11, 6330 Cham, Switzerland
Contents
Genomics and Functional Genomics in Chlamydomonas reinhardtii . . . . 1

Ian K. Blaby and Crysten E. Blaby-Haas
Nuclear Transformation and Toolbox Development . . . . . . . . . . . . . . . . 27
Jan H. Mussgnug
Mitochondrial Bioenergetics Pathways in Chlamydomonas . . . . . . . . . . 59
Simon Massoz, Pierre Cardol, Diego González-Halphen, and Claire
Remacle
Bioenergetic Pathways in the Chloroplast: Photosynthetic Electron
Transfer . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 97
Philipp Gäbelein, Laura Mosebach, and Michael Hippler
Chlamydomonas: Bioenergetic Pathways—Regulation
of Photosynthesis . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 135
Jun Minagawa
Chlamydomonas: Anoxic Acclimation and Signaling . . . . . . . . . . . . . . . 155
Anja Hemschemeier
Chlamydomonas: Regulation Toward Metal Deficiencies . . . . . . . . . . . . 201
Eugen I. Urzica
Calcium-Dependent Signalling Processes in Chlamydomonas . . . . . . . . 233
Glen L. Wheeler
Chlamydomonas: The Eyespot . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 257
Mark D. Thompson, Telsa M. Mittelmeier, and Carol L. Dieckmann
v
Genomics and Functional Genomics
in Chlamydomonas reinhardtii
Ian K. Blaby and Crysten E. Blaby-Haas
Abstract The availability of the Chlamydomonas reinhardtii nuclear genome

sequence continues to enable researchers to address biological questions relevant to
algae, land plants, and animals in unprecedented ways. As we continue to character-
ize and understand biological processes in C. reinhardtii and translate that knowledge
to other systems, we are faced with the realization that many genes encode proteins
without a defined function. The field of functional genomics aims to close this gap
between genome sequence and protein function. Transcriptomes, proteomes, and
phenomes can each provide layers of gene-specific functional data while supplying
a global snapshot of cellular behavior under different conditions. Herein we present a
brief history of functional genomics, the present status of the C. reinhardtii genome,
how genome-wide experiments can aid in supplying protein function inferences, and
provide an outlook for functional genomics in C. reinhardtii.
1 Introduction
The first bacterial genome sequence, completed in the mid-1990s (Fleischmann

et al. 1995), was rapidly followed by a succession of milestone accomplishments
[e.g., the first eukaryote in 1996 (Goffeau et al. 1996), the first plant genome in 2000
(Kaul et al. 2000), and the first mammalian genome in 2002 (Waterston et al.
2002)]. These achievements marked the beginning of a new era in biological
sciences. The resulting post-genomic age has equipped researchers with the genetic
blueprints for thousands of organisms. Unfortunately, however, it is not immedi-
ately clear how these blueprints translate into complex, thriving, and adaptable
organisms. Indeed, a key observation made with early genome sequences, and
subsequently echoed with each new genome, is that we have complete functional
understanding for a small percentage of the encoded proteins [although this perhaps
came as little surprise (Bork et al. 1992a, b)]. Increases in the speed of sequence
acquisition, accuracy (due in large part to increased depth, or coverage, of
I.K. Blaby (*) • C.E. Blaby-Haas

Biology Department, Brookhaven National Laboratory, 50 Bell Avenue, Building 463, Upton,
NY 11973, USA
e-mail: [email protected]
© Springer International Publishing AG 2017 1

M. Hippler (ed.), Chlamydomonas: Molecular Genetics and Physiology,
Microbiology Monographs 30, DOI 10.1007/978-3-319-66365-4_1
2 I.K. Blaby and C.E. Blaby-Haas
sequence), reductions in cost per genome, and the required sample size have
resulted in the pace of genome sequencing far outstripping experimental validation
of gene function. Consequently, biologists are presently working with a growing
parts list without the knowledge as to what the pieces do, how they interact and how
this results in a functioning cell.
1.1 What Is Functional Genomics?
Fortunately, a key development that came with the first genome sequences was the
birth of functional genomics (Hieter and Boguski 1997). Functional genomics lies
at the interface of two revelations: first, each genome encodes a plethora of proteins
with unknown or poorly defined function; second, each genome provides a list of
those proteins enabling the scale-up of experiments to simultaneously inform on the
function of as many of them as possible (Fig. 1). Determining protein function plays
a large part in modern biology generally, but what distinguishes functional geno-
mics from other fields is that protein function is informed by genome-wide studies,
such as transcriptomics and proteomics, and high-throughput screening including
protein-protein interactions, global protein localization efforts, and mutant library
phenotyping (phenomics) (Fig. 1).
As of yet, no single functional genomics approach has come close to deciphering
the function of every protein in a given genome. Instead each experiment provides a
single, global (but condition-specific) snapshot. The field therefore also encompasses
computational analyses that endeavor to establish bridges between the mountains of
high-throughout (HTP) genome-wide experimental data and protein function. Inte-
gration of functional genomics experiments and other genome-based analyses such as
comparative genomics can generate functional inferences. Functional genomics can
overlap significantly with systems biology, since both fields employ global approaches
to experimentation. Accordingly, systems-wide studies can be highly informative to
genome transcriptome proteome phenome modeling biological function
AA
AA AA
AAAA
AA
AA
AA
AA
functional genomics
Fig. 1 The genome provides the raw sequence to which genes can be mapped. The function of
proteins encoded by those genes can be informed through functional genomics experiments that
relate biological information such as changes in transcript or protein abundance and phenotypes to
each locus. In order to maximize the value of genome-wide studies, computational analyses and
modeling are needed to gain a systems-level understanding of biological function from these
experimental pieces
Genomics and Functional Genomics in Chlamydomonas reinhardtii 3
protein function where data is accumulated and interpreted from a holistic perspective.
Thereupon, functional genomics and systems biology can form the basis of, and
inform the design of, metabolic engineering and synthetic biology approaches.
1.2 What Is Protein Function?
Function is a multifaceted description of a protein’s role in the cell. This description

has both biochemical and biological elements. For an enzyme, the function would
require understanding the reaction(s) catalyzed, the pathway or process the protein
participates in, the location of the protein within the cell, how the gene and encoded
protein are regulated, and what cofactors are required for activity. As experimental
evidence for each of these attributes is provided, the annotation approaches a “gold-
standard” level. By virtue of the detailed level of genetic/biochemical character-
ization to achieve this status, these experiments tend to be performed in laboratories
with expertise in the process or pathway under examination, adding an additional
level of robustness to the resulting functional annotations.
1.3 The Functional Annotation Problem
Traditionally, functional characterization of proteins has largely been performed

one protein at a time. As the number of uncharacterized proteins (individual pro-
teins and protein families) increases with each new genome sequence, the detailed
but time-consuming characterization of one protein at a time is an impracticable
approach to understanding the function of every protein in every organism. A
compromise has been to transfer, or propagate, experimentally determined func-
tions (called functional annotations) to non-experimentally characterized proteins
employing sequence similarity. In an age where protein sequences are at our finger-
tips and bioinformatics play an increasingly large part in biological research,
automated functional annotations abound in online databases. It is often difficult
to know where annotations originated (i.e., by whom and in which organism the
experimental validation was performed) and how reliable they are.
The logic of most automated protein functional annotation is based on the evol-
utionary concepts of orthology and ancestral relationships; a function may be shared
among members of a protein family. Such methods are routinely implemented using
BLAST (Altschul et al. 1990, 1997). While some estimates for reliability of
similarity-based approaches have been determined (Tian and Skolnick 2003), this
mechanism of annotation is generally confounded by the fact that function may not
be conserved between even highly similar sequences. Conversely, proteins with
dissimilar sequences may have the same function (for example, due to convergent
evolution). Furthermore, as a consequence of runaway annotation propagation from
genome to genome, 60% of database-deposited functional annotations are estimated
to be incorrect for some protein families (Schnoes et al. 2009).
At some point, the genome being automatically annotated is so phylogenetically

distant from the organism in which the original function-determining experiment
was actually performed that the annotation becomes less relevant and ultimately
invalid. This problem is particularly acute for organisms that are evolutionarily
distant from very well experimentally characterized model organisms. Automated,
structured classifications comprising strictly controlled vocabularies, such as those
provided by the gene ontology (GO), and plant-specific tools such as MapMan
(Thimm et al. 2004) and Mercator (Lohse et al. 2014) mitigate this annotation error
to some extent but generally fail to link an annotation to a specific piece of evidence
(Rhee et al. 2008).
1.4 Why Use Functional Genomics?
Each type of functional genomics experiment provides a snapshot of some func-

tional data for many, if not all, genes in an organism at relatively little expense
(in terms of time and finance). Although highly detailed protein characterization
necessitates expert experimental validation, functional genomics can quickly pro-
vide testable hypotheses that drastically reduce the time at the bench it takes for
detailed characterization of protein function.
2 Chlamydomonas reinhardtii Genomics
2.1 The Status of Protein Function Annotation

in Chlamydomonas
A wide range of biological phenomena is studied in C. reinhardtii (herein Chla-

mydomonas), resulting in a wealth of information about Chlamydomonas and by
extension plants and animals (Harris 2001, 2009; Goodenough 2015). The Chla-
mydomonas nuclear genome encodes roughly 19,500 proteins (17,741 loci with
19,526 putative transcripts in JGI 5.5/Phytozome 10 gene model version). The
sequence of each protein is predicted from a gene model, which is derived from a
combination of prediction tools and sequenced transcript data (such as expressed
sequence tags (ESTs), full-length cDNAs, and RNA-Seq reads). Some of these
genes are possibly pseudogenes, but it is expected that the number of non-expressed
genes is less than 2500 (Zones et al. 2015). All other genes perform some role
ensuring that each Chlamydomonas cell survives to the next generation.
Yet, despite intensive study for more than half a century, the role of many genes in
Chlamydomonas is unknown (Table 1). This situation is not uncommon. The first
eukaryotic genome sequenced, belonging to Saccharomyces cerevisiae (Goffeau et al.
1996) and by far the most characterized eukaryotic genome to date, contains 30% of
genes that are not associated with a biological process and 40% that are not associated
Table 1 Gene annotation status in Chlamydomonas

Annotation typea Number of genes Fraction (of primary transcriptsb) (%)
Primary gene symbolc 1815 10.2
Defline and/or descriptionc 7834 44.2
PFAM domainc 9242 52.1
GO ontologyc 6636 37.4
MapMan ontologyd 5685 32.0
Loci that have none of the above 5699 32.1
a
Determined using v5.5 models, data collected March 2016
b
Since alternate transcripts (i.e., splice variants) are almost entirely predicted, only primary
transcripts are analyzed here
c
Data sourced from Phytozome (Goodstein et al. 2012)
d
Thimm et al. (2004)
with a molecular function even though nearly 80% of genes are linked with some form
of experimental evidence (as of 24 March 2016; http://www.yeastgenome.org/
genomesnapshot). One can imagine that the state of gene function knowledge in
more complex eukaryotes such as plants, which have many more genes, is by compar-
ison limited (Chlamydomonas has nearly 10,000 more genes than S. cerevisiae,
although there is likely some functional redundancy due to gene duplications).
To a certain extent experimental characterization in other organisms can provide
some functional information. For instance, about 10,000 Chlamydomonas proteins
have at least one PFAM domain (Table 1; however, some of these domains are not
associated with a known function). A combination of sequence similarity, more
stringent bioinformatics analyses, and experimental evidence has led to annotation
of approximately 10% of predicted Chlamydomonas transcripts (Table 1). Making
inroads into deciphering complete function of the remaining 90% of genes and
placing these genes in a biological context requires functional genomics approaches.
2.2 The Chlamydomonas Nuclear Genome and Gene Models
Since many techniques in functional genomics rely on accurate gene models and
protein sequences, we start our discussion of functional genomics in Chlamydo-
monas with a prelude on structural genomics. Raw genome sequence indicates little
of biological function. A critical step prior to assigning and defining functional
annotations, which describe the role of an encoded protein, is to physically annotate
a genome (otherwise known as structural genomics). Physical annotations define
the structural attributes of the genome, such as the number and size of chromo-
somes/scaffolds, positions (i.e., coordinates) of genes on chromosomes, intron/exon
junctions, transcription start/stop sites, and translation start/stop sites. Since the
accuracy of the predicted protein sequence is dependent upon the quality of the
raw genome sequence and accuracy of the gene models, it is crucial for the phys-
ical annotations to be of a very high standard before functional annotations can be
reliably applied. Fortunately, as a result of numerous efforts integrating
new computational algorithms and the incorporation of experimental datasets, the

quality of the Chlamydomonas genome and its gene models are of a high level, as
described herein.
After initiation of the Chlamydomonas genome project in the early 2000s and
subsequent to two early releases, the draft Chlamydomonas genome (v3) was
published in 2007 (Merchant et al. 2007), achieving an averaged 13x coverage by
Sanger-based sequencing of 2.1 million reads (Table 2). The draft genome assem-
bly was annotated with the aid of de novo gene prediction tools. This suite of tools
comprised statistical models, which computationally scanned the genome for
occurrences of putative open reading frames (as determined by translational start
and stop sites) and possible intron/exon splice junctions. These models incorporated
homology data of translated sequence to known proteins/conserved domains and
were supported in conjunction with ~0.25 million ESTs (Haas et al. 2003, 2008;
Holt and Yandell 2011). These methods resulted in the JGI v3 generation of gene
models, released in 2005 (Table 2). The collection consisted of 15,143 predicted
transcripts, of which 82 had manually annotated alternate splice forms, and was
deposited in NCBI databases under accession number ABCN01000000 (Merchant
et al. 2007). For nomenclature purposes each transcript was assigned a unique
six-digit ID. Concurrently with the JGI-led effort, an independent investigation was
performed in which a collection of >2000 cDNAs was used as a training set for
ab initio gene identification. This study resulted in the GreenGenie2 catalog of gene
models (Kwan et al. 2009). As an indication of robustness of these two gene model
collections, most (78%) putative transcripts overlapped between the two collec-
tions, although many were unique to either the GreenGenie2 (23%) or JGI v3 (22%)
collections, suggesting additional work was necessary to capture the complete
coding sequence.
A series of successive generations incorporating new methods, data, and algo-
rithms have built upon these early releases resulting in improvements to both the
genome assembly and the gene models (Blaby et al. 2014). These post-publication
updates started with targeted Sanger-based sequencing of regions with low quality
in combination with manual attempts at gap closing. The new sequence attained
from these approaches was assisted by a genetic map (Rymarquis et al. 2005),
aiding the positioning of scaffolds onto chromosomes. These approaches enabled
Table 2 History of Chlamydomonas genome assemblies and generations of gene models

Number of
Genome Number of scaffolds Total Gene model transcripts
assemble (of which sequence Mb version (alternate
(release date) chromosomes) (% gaps) (release date) transcripts)
3 (2006) 1557 (na) 120.2 (12.5%) JGI v3 15,143 (82)
4 (2008) 88 (17) 112.3 (7.5) JGI v4 16,709 (0)
Aug u5 15,818 (1070)
Aug u9 15,935 (0)
JGI v4.3 17,114 (0)
5 (2012) 54 (17) 111.1 (3.6%) JGI v5.3.1 17,737 (1789)
JGI v5.5 17,741 (1785)
significant forward strides to be made; the total number of scaffolds reduced from
1557 in v3 to 88 in the v4 assembly, providing the basis for several rounds of gene
model improvements. The first generation of gene models made available for
assembly v4, known as JGI v4, constituted 16,709 transcripts. Although this
collection of models did not officially support alternate transcripts, analysis by
Labadorf et al. inferred 611 alternative splice variants (Labadorf et al. 2010).
Subsequent updates were made possible by incremental improvements in the
Augustus algorithm, which supported inclusion of EST data (Stanke et al. 2008),
and proteomic data (Specht et al. 2011). Consequently, these model collections,
released between 2008 and 2012, saw the predicted transcript number increase from
15,818 with the Aug5 release to 17,114 with the Aug10.2 release (Table 1). This
latter release, known as JGI v4.3, benefited significantly from the advent of second-
generation sequencing technologies, and the inclusion of >6 million ESTs
sequenced on the 454 platform, as well as homology to the then-recently sequenced
Volvox carteri genome (Prochnik et al. 2010). The adoption of Augustus for gene
model identification also marked the transition to the now-standardized (and per-
manent) system for Chlamydomonas loci ID, written in the format CreX.gY. In
similar fashion to Arabidopsis loci identifiers (written as ATXGY ), Cre indicates
the organism (Chlamydomonas reinhardtii), X denotes the chromosome/scaffold,
and Y is a unique six-digit identifier, which proceeds in numerical order from the
“beginning” of chromosome 1 to the “end” of the final scaffold. Initially this
identifier increased in increments of 50, thus allowing for the incorporation of
new genes without the need for all subsequent loci ID to be reshuffled. JGI v4.3
represented the final gene model version to be based upon the v4 genome.
Work on the next (and, presently, the most up-to-date) revisions to both the
nuclear genome sequence and gene models, v5 and v5.5, respectively, took full
advantage of advances in second-generation sequencing technologies and was
released in mid-2012. Efforts were made to close remaining gaps in the genome
sequence by construction of new genomic fragment libraries of differing insert
sizes [as a means of compromising between achieving some sequence (with small
inserts) and sequencing across repetitive sequence (with long inserts)] with a
combination of Sanger and 454-based technologies. These endeavors resulted in
reducing the total number of scaffolds from 88 in v4 to 54 in v5 (Table 2). In its
present state (v5), the genome totals 111.1 Mbp, averages 65% GC, and comprises
17 chromosomes plus additional 37 repeat-rich non-anchored scaffolds. These
chromosomes and scaffolds range ~1–10 Mbp and 0.1–0.8 Mbp, respectively.
Common metrics used to describe the quality of a draft genome are the N50 and
L50 statistics. N50 describes the smallest number of sequenced fragments required
to make 50% of the complete assembly, and L50 is the size of the smallest fragment
within the fragments comprising N50. Thus, a more complete genome will have a
higher N50 and a lower L50 than a less complete genome of the same size. As work
on the Chlamydomonas genome has progressed, the N50 has reduced from 24 to
7, and the L50 has increased from 1.7 to 8 Mb between v3 and v5.
Building upon the JGI v4 gene model inventory, extensive revisions, incorporat-
ing more than a billion reads from 59 independent RNA-Seq experiments, including
paired reads and stranded libraries (enabling direction and strand of the model to be
determined), were incorporated into an updated Augustus algorithm (Aug11.6) and

resulted in the v5.3.1 gene model catalog. During this transition, many complex
revisions to gene models were made, such as splitting a single-gene model into
multiple models and fusing several models into one (causing additional complica-
tions if a named gene is split; in such cases, the name migrated with the conserved
domain). Consequently, 28% of loci could not be easily mapped forward and were
provisioned with a temporary loci ID in the format g.X, where X provided a unique
placeholder ID. Another, relatively minor, update released in 2014 (v5.5) amended
these temporary loci by employing a more robust technique to map ~74% of loci
from v4.3 resulting in gene models v5.5. Approximately 15% of gene models were
given a new locus as a result of movement between chromosomes/scaffolds. The
remaining ~12% could not easily be mapped from the v4 assembly to v5 and were
also provided with a new locus. Minor changes were also made to a handful of gene
models, with four loci each splitting into two in going from v5.3.1 to v5.5.
As it currently stands in this most recent iteration, the Chlamydomonas reference
genome encodes 17,741 transcripts plus 1785 alternate transcripts resulting from
splice variants. The coding sequence has an average GC skew of 68% although
there is significant deviation between genes. More than 10% (2388) of predicted
transcripts have a GC content of 75%; astonishingly, a handful (66) contain
80% GC. At the other end of the scale, 138 contain 55%. These outliers may
represent recent acquisitions by horizontal gene transfer and have potentially not
yet ameliorated to the average GC content. On the whole, it appears that genes
containing a slight skew toward high GC content are more highly expressed, at least
at the level of mRNA. By ranking genes by mRNA abundance (i.e., reads per kb per
million bases; RPKM) and identifying the top 200 transcripts conserved in five
RNA-Seq experiments (Castruita et al. 2011; Boyle et al. 2012; Urzica et al. 2012;
Malasarn et al. 2013; Wakao et al. 2014), the codon usage of genes highly
expressed in diverse conditions was determined (Table 3). The average GC content
in these genes was 64%, with 88% GC at the third base. This codon usage data may
aid in efforts for high expression of genes in metabolic engineering.
2.3 Present and Future Directions for the Chlamydomonas

Nuclear Genome
As with all draft genomes, work continues on both the assembly (continued gap
closing) and gene models. Chlamydomonas loci IDs are now static (or will deviate
only marginally to allow for transfer of loci as required for future updates). How-
ever, the complicated history and the number of studies conducted using earlier
generations of gene models necessitate the need to translate between versions.
Correspondence tables are available to download for this purpose (http://phyto
zome.jgi.doe.gov/pz/portal.html). Several studies have highlighted potential direc-
tions for future exploration, including a recent genomic analysis suggesting that a
fraction of gene models could be extended at the N-terminus (Cross 2015). Although
the analysis is entirely of an informatic nature, the implications this may have on
Table 3 Codon usage of highly expressed genes in Chlamydomonas
Codon aa % Codon aa % Codon aa % Codon aa %
U UUU F 0.33 UCU S 0.46 UAU Y 0.20 UGU C 0.06 U
UUC F 3.18 UCC S 1.80 UAC Y 2.51 UGC C 1.50 C
UUA L 0.05 UCA S 0.11 UAA STOP 0.31 UGA STOP 0.45 A
UUG L 0.14 UCG S 1.83 UAG STOP 0.33 UGG W 1.08 G
C CUU L 0.30 CCU P 0.60 CAU H 0.14 CGU R 0.69 U
CUC L 1.01 CCC P 3.34 CAC H 1.70 CGC R 4.75 C
CUA L 0.10 CCA P 0.16 CAA Q 0.16 CGA R 0.05 A
CUG L 6.25 CCG P 1.00 CAG Q 3.31 CGG R 0.59 G
A AUU I 1.15 ACU T 0.64 AAU N 0.13 AGU S 0.13 U
AUC I 3.05 ACC T 3.50 AAC N 3.30 AGC S 1.75 C
AUA I 0.04 ACA T 0.14 AAA K 0.08 AGA R 0.03 A
AUG M 2.79 ACG T 0.78 AAG K 7.37 AGG R 0.19 G
G GUU V 0.68 GCU A 2.13 GAU D 0.69 GGU G 1.43 U
Genomics and Functional Genomics in Chlamydomonas reinhardtii
GUC V 2.32 GCC A 6.12 GAC D 4.21 GGC G 6.29 C

GUA V 0.06 GCA A 0.33 GAA E 0.09 GGA G 0.17 A
GUG V 4.61 GCG A 2.10 GAG E 5.68 GGG G 0.28 G
U C A G
9
predicted protein sequence warrant further attention. Another study suggests exonic
regions are not included in the present reference assembly genome, potentially
indicating that the complete coding sequence (and consequently protein sequences)
is not represented (Tulin and Cross 2015). A further issue requiring attention is the
omission of a number of gene models, possibly numbering on the order of a
few hundred, that were represented in v4.3 but are not present in v5.5 (Blaby,
unpublished). It is presently unknown as to why these models were not picked up
by the Augustus 11.6 algorithm as many are highly supported by ESTs/RNA-Seq
datasets and include, for example, PSBW, encoding the W protein of photosystem II.
3 Functional Genomics in Chlamydomonas
Here, we define a functional genomics dataset as the cumulative results of a

genome-wide experiment. Specifically, the data has to be linked directly to precise
gene loci or proteins. Needless to say, a functional genomics experiment attempts to
inform on every gene, transcript or protein in the cell. However, the extent to which
a global investigation is truly genome-wide is dependent on the technique used. In
this section, we discuss the three predominant types of functional genomics studies
in Chlamydomonas: mRNA quantification (transcriptomics), protein detection and
quantification (proteomics), and mutant phenotype screening (phenomics). Tran-
scriptomic methods (mainly microarray and RNA-Seq) enable high-throughput
examination of gene expression, identifying genes whose mRNA abundance alters
significantly between experimental conditions (environment) or strains (wild-type/
mutant comparisons). In Chlamydomonas, RNA-Seq, a deep-sequencing technol-
ogy, comes the closest to providing quantitative data on every gene on the genome
(theoretically informing on every gene model, assuming sequencing depth is
sufficient). Proteomic methods can provide information on where proteins are in
the cell, an indication of where they perform their function, and can provide
information of the differential abundance of proteins between conditions or strains.
Proteomic approaches have been able to inform on the presence of 3500 Chlamydo-
monas proteins in a single study and differential abundance demonstrated for
approaching 1000 proteins (Park et al. 2015). Phenomic methods traditionally
rely on availability of a library of single-gene deletions or disruptions. The library
is screened for mutant phenotypes that deviate from the parent strain used to
construct the library (growth defect, colony morphology, chlorophyll content,
etc.) when grown under precise conditions (such as high light, low nutrient avail-
ability, etc.). Efforts are being made to provide a sequenced insertional library
(Li et al. 2016), which may enable functional genomics studies of mutant pheno-
types. In the meantime, phenomic studies in Chlamydomonas are limited to forward
genetic screens of un-sequenced libraries, isolation of mutants with desired pheno-
types, and the subsequent identification of the site of mutation.
3.1 Transcriptomics
Transcriptomes offer a valuable tool in the functional genomics arsenal by provid-

ing a snapshot of transcript abundance under well-defined conditions for a large
number of transcripts. Transcript abundance changes can be used in several ways to
infer function. Higher mRNA abundance in one growth condition (e.g., low-sulfur
medium) compared to a second growth condition (such as sulfur-replete medium)
can give an indication as to when the gene product is needed (growth during sulfur
starvation). There are however several assumptions being made in this simplistic
type of function deduction. It can be difficult to know if the observed transcript
changes are due to the experimental variable (presence/absence of sulfur) or an
indirect consequence of the variable (perhaps redox stress), leading to the question
“is the corresponding protein involved in sulfur metabolism or a downstream
process?” Also, in some cases, transcript abundance may be linked to a feedback
response involving activity of the encoded protein during the experimental condi-
tion. For instance, under iron starvation, the abundances of transcripts encoding
several iron-dependent proteins increase, while the protein’s abundance decreases;
it appears that the increase in transcript abundance is responding to the reduced
activity of these iron-dependent proteins during iron deprivation rather than a role
for these proteins in acclimating to poor iron nutrition (Urzica et al. 2012). The
identification of co-expressed genes can also inform function using the “guilt-by-
association” principle (Niehrs and Pollet 1999), whereby the function of a gene is
inferred by its co-expression with another gene of known function.
Transcriptomics in Chlamydomonas can be traced back to the first DNA
microarrays containing probes to detect the differential abundance of ~3000 assem-
bled ESTs (Fig. 2) (Im et al. 2003). These early transcriptomes provided data on the
influence of several environmental conditions on transcript abundance, including
light and CO2 (Im et al. 2003), sulfur nutrition (Zhang et al. 2004), and photooxi-
dative stress (Ledford et al. 2004). As the EST library grew (Asamizu et al. 2004),
DNA microarrays grew to measure over 10,000 ESTs. After the release of the draft
Chlamydomonas nuclear genome in the early 2000s, genomic information in addi-
tion to ESTs was used in the design of microarrays (Eberhard et al. 2006). The first
“whole genome” microarray was published in 2005 and based on gene models
associated with draft v2 of the nuclear genome (Stolc et al. 2005). Subsequent
microarrays have been designed and employed as more accurate genome sequence
drafts and accompanying gene models were released, but in large part, microarray
technology has been supplanted by quantitative cDNA sequencing (i.e., RNA-Seq).
Reductions in cost and sample size, fast turnaround, and streamlined bioinfor-
matic applications (reviewed in Van Verk et al. 2013) have resulted in a swelling
stream of Chlamydomonas RNA-Seq datasets. Furthermore, RNA-Seq datasets
adapt to changes in gene models, since the raw sequenced reads can be realigned
should updates occur subsequent to the experiment being performed. The types of
experiments published over the past 5 years reflect the status of Chlamydomonas as
a popular microbial experimental system for studying photosynthesis, nutrition,
cilia, and abiotic stresses.
v5
20 genome paper
v4
RNA-Seq experiments are
proteins/transcripts (x1000)
16 v3 typically mapped to
17,741 gene models
v2
12
v1
8 # of non-redundant proteins in
NCBI's Protein database
1st microarray # of transcripts
51 nuclear genes (microarray and RNA-Seq)
4
gene models
0
1990
1995
2000
2005
2010
2015
year
Fig. 2 Progress of genomics and transcriptomics in Chlamydomonas. The green line represents
number of nuclear-encoded protein sequences in GenBank starting at 1990. Because of the
redundancy caused by duplicated entries, protein entries from each year were mapped to JGI
5.5. If the sequence could not be mapped forward, it was not included in the graph. The number of
entries in GenBank significantly increased with deposition of predicted proteins associated with
the genome publication (Merchant et al. 2007), with only a handful of new sequences deposited
subsequently. Presently, about 70% of Chlamydomonas proteins in the Phytozome 11 database are
represented in GenBank, and the gene models associated with many of those deposited in 2007
have changed as a result of more accurate genome assemblies and gene model prediction
algorithms. Gray bars indicate the number of gene models released to the public in the indicated
years that map onto the v5.5 gene models. The purple line represents the progress of
transcriptomics in Chlamydomonas; the number of “gene-specific” probes reported for each
microarray is given, but it should be noted that there are potential redundancies and artifacts due
to the limited availability of accurate gene models when many of these microarrays were designed.
Starting in 2002 (Lilly et al. 2002) with a microarray that included probes for 51 nuclear genes,
transcriptomics of the nuclear genome progressively increased in scope over the next decade. As
EST libraries were made public followed by the first drafts of the nuclear genome, the size of
microarrays continued to increase, while the publication of Chlamydomonas RNA-Seq experi-
ments began in 2010. Although the present release of JGI gene models includes alternative
transcripts, most RNA-Seq analyses only include mapping to the primary transcripts
3.2 Proteomics
One must remember that transcriptome data only gives an indication of transcrip-
tional and post-transcriptional regulation of mRNA abundance. Many proteins in
the cell, however, are regulated at the posttranslational level either through post-
translational modifications or degradation. The detection and quantification of these
condition-specific changes require analysis of proteins. The history of proteomics in
Chlamydomonas is similar to that of transcriptomics: the number of proteins identi-
fied and quantified in a typical experiment has increased with time largely due to
availability of the genome sequence (for identification of peptides/proteins) and
technological advancements (Rolland et al. 2009).
To gain a functional genomics insight, differential abundance measurements

from a quantitative proteomics study utilize the same logic as a transcriptomics
study. The assumption is that proteins that are more abundant in a test condition
verses standard growth conditions are involved in acclimating to that test condition
thus inferring a functional role. Several studies have been performed in Chlamydo-
monas where researchers quantify changes in the transcriptome and proteome. In
general, RNA-Seq and microarrays are able to quantify transcripts from an order of
magnitude more genes than proteins using shotgun proteomics (Hsieh et al. 2013;
Mettler et al. 2014; Schmollinger et al. 2014).
Unlike transcriptomics, proteomics can inform function by cataloging the loca-
tion of proteins within the cell. In this case, proteins are identified after purification
of the target compartment or structure. MS-based identification has been performed
on proteins present in (and from a functional genomics perspective assumed to
carry out a biological role in) the chloroplast (Allmer et al. 2006; Terashima et al.
2010, 2011; Bienvenut et al. 2011), the eyespot (Schmidt et al. 2006; Wagner et al.
2008; Eitzinger et al. 2015), flagella (Keller et al. 2005; Pazour et al. 2005;
Diener et al. 2015), mitochondria (Atteia et al. 2009), nucleus (Winck et al. 2012),
and lipid bodies (Moellering and Benning 2010; Nguyen et al. 2011).
3.3 Phenomics
For geneticists, a condition-specific phenotype resulting from the disruption of a

single gene represents the Holy Grail in understanding the function of that disrupted
gene. Given this, it comes as little surprise that for many organisms, the creation of
an indexed, genome-wide mutant library [typically defined as containing indepen-
dent disruptions in 85% of predicted genes (Carpenter and Sabatini 2004)] follows
shortly after attainment of the genome sequence (Winzeler et al. 1999; Alonso et al.
2003; Baba et al. 2006). With such a library in hand, researchers begin screening the
library under various growth conditions and cataloging the measured phenotypes
associated with each disrupted locus. HTP phenotypic profiling enables systematic
genotype-to-phenotype relations to be generated. This approach differs from the
classical forward genetic screen, where researchers are seeking the genetic basis for
a particular phenotype. With reverse genetics, researchers are seeking phenotypes
associated with each genotype.
Typically, a large number of parameters are collected, either sequentially or
simultaneously, to generate comprehensive datasets for each mutant strain’s phe-
nome. Similar logic as with gene co-expression can be applied: if two strains
deleted for different genes display similar phenotypes under the same conditions,
there may be a functional linkage. This field is presently in its infancy in Chlamydo-
monas, although it is primed to come online in the near future as the known site-of-
insertion mutant libraries become available (Li et al. 2016).
Table 4 Summary of data repositories and online tools enabling genomics and functional genomics in Chlamydomonas
14
Purpose for using

Chlamydomonas Tools for
genome assembly/ Genomic/functional Functional validating
gene model genomics data genomics analysis Comparative functional
Tool/database Location generationa repository abilities genomics abilitiesb analysis
Phytozome http://www. v5/v5.5 Primary repository Contains user- Genomic data for
(Goodstein et al. phytozome.net of Chlamydomonas validated annota- >40
2012) genome/gene tions, and PFAM, plants/photosynthetic
models. Can bulk Panther and GO organisms
download data as predicted annota-
well as obtain tions. Gene
correspondence co-expression tool
tables to translate utilizing some
gene model IDs transcriptomes
UCLA algal http://genomes.mcdb. v3–v5/ Chlamydomonas Multiple Can compare relative
genomics portal ucla.edu/ (transcriptomes genome browser, transcriptomes mRNA abundances of
presently based on the UCSC available to view genes in different
available mapped browser (Kent et al. in genome conditions
to v4/v4.3) 2002). Can bulk browser
download some
genomic data
Algal Annotation http://pathways.mcdb. v3–v5 Batch conversion Bulk annotation
Tool (Lopez et al. ucla.edu/algal/index. of gene identifiers prediction via
2011) html Kegg, MapMan,
GO, Panther,
Metacyc. Gene
co-expression tool
utilizing some
transcriptomes
I.K. Blaby and C.E. Blaby-Haas
NCBI http://blast.ncbi.nlm. v3/JGIv3 Presently the only
nih.gov/Blast.cgi? online resource to
PAGE¼Proteins query
Chlamydomonas
using PsiBlastc
(Altschul et al.
1997)
Predalgo (Tardif https://giavap- N/A (dependent Green algal-
et al. 2012) genomes.ibpc.fr/cgi- upon user-provided specific protein
bin/predalgodb.perl? sequence) localization
page¼main predictions
Plant Transcrip- http://plntfdb.bio.uni- v4/v4.3 Prediction of all Database covers
tion factor data- potsdam.de/v3.0/ genome-encoded 20 photosynthetic
base (Pérez- index.php?sp_ transcription organisms
Rodrı́guez et al. id¼CRE4 factors
2010)
PLANTTFDB http://planttfdb.cbi. v4/v4.3 Predicted Database covers
(Jin et al. 2014) pku.edu.cn/ genome-encoded 83 photosynthetic
transcription species
factors
cis-regulatory http://hulab.ucf.edu/ v4/JGIv4.3 Gene regulatory
site prediction research/projects/ element
tool (Ding et al. Microalgae/sdcre/ prediction

2012) motifcomb.html
AlgaePath http://algaepath.itps. v5/v5.3.1 Maps mRNA Analysis can also
(Zheng et al. ncku.edu.tw/algae_ abundance from a be performed
2014) path/home.html number of on Neodesmus
transcriptomes to sp. UTEX 2219–4
KEGG pathway
maps
(continued)
15
Table 4 (continued)
16
Purpose for using

Chlamydomonas Tools for
genome assembly/ Genomic/functional Functional validating
gene model genomics data genomics analysis Comparative functional
Tool/database Location generationa repository abilities genomics abilitiesb analysis
ALCOdb (Aoki http://alcodb.jp/ v5/v5.5 Microalgal gene Identifies orthologs
et al. 2016) co-expression in Cyanidioschyzon
networks merolae, for which
(microarray-based)
co-expression
networks are also
present
ChlamyChem http://chlamychem. Phenotypic and
(Alfred et al. utoronto.ca/ chemical screen
2012) ChlamyChem/down resource
load.php
ChlamyCyc5 http://pmn.plantcyc. v3/JGIv3
(May et al. 2009) org/organism-sum
mary?
object¼CHLAMY
PlantSEED http://bioseed.mcs.anl. v3/JGIv3 Comparative platform
(Seaver et al. gov/~seaver/FIG/ embodying the
2014) seedviewer.cgi? “subsystem”
page¼PlantSEED approach for genome
annotation (Overbeek
et al. 2005)
pico-PLAZA http://bioplaza/plaza/ v4/JGI4.3 Comparative platform
(Vandepoele versions/pico-plaza/ for genomics analysis
et al. 2013) of Chlamydomonas
I.K. Blaby and C.E. Blaby-Haas
PlantGDB http://www.plantgdb. v4/JGIv4.3 Genome repository Comparative
(Duvick et al. org/ and browser genomics platform
2008) for >100 plants,
genome browser for
14 species
ChlamyNET http://viridiplantae. v5/v5.5 Chlamydomonas
(Romero- ibvf.csic.es/ gene
Campero et al. ChlamyNet/ co-expression net-
2016) works, putative
transcription fac-
tor binding site
predictions
Chlamydomonas http:// Distributes
Resource Center chlamycollection.org/ >5000 cataloged
Chlamydomonas
strains, in addi-
tion to
phenotyped and
sequenced
mutant collec-
tions (Dent et al.
2015; Li et al.
2016). Also
stocks, plasmids,
cDNA libraries,
kits, etc.
ChlamyStation http://chlamystation. Paris (IBPC)
free.fr/ Collection of
photosynthesis
mutants
a
As of March 2016
b
Defined here as a tool that can directly comparatively analyze data between (1) organisms or (2) conditions within an organism
17
c
Later versions of the genome/gene models can be queried by running PsiBLAST on a local terminal; source code is available at https://blast.ncbi.nlm.nih.gov/
Blast.cgi?PAGE_TYPE¼BlastDocs&DOC_TYPE¼Download
3.4 Other “Omics” Experimental Types
Other global studies, such as metabolomes and lipidomes, have been conducted in
Chlamydomonas. These investigations can illuminate changes within the cell on the
systems level. From a functional genomics perspective of linking function to
specific proteins, the data generated from these types of experiments can be useful
when viewed in the context of other datasets (such as those described in this
section) that can ascribe each observation to a specific loci. Several studies in
Chlamydomonas have taken this multi-“omic” approach to understanding how
Chlamydomonas acclimates to different growth conditions, such as rapamycin
treatment (Kleessen et al. 2015), nutrient deprivation (Schmollinger et al. 2014;
Park et al. 2015), oxygen status (Subramanian et al. 2014), temperature (Légeret
et al. 2016), and light (Mettler et al. 2014).
3.5 Databases and Resources for Chlamydomonas Genomics

and Functional Genomics
A growing number of online resources are available to curate, disseminate, and

interpret Chlamydomonas genomics datasets, as well as catalogs for resource distri-
bution (such as strains and vectors). These tools range from data repositories to
sophisticated platforms enabling integrative analysis of different data types, includ-
ing comparative analyses with other organisms. We have summarized a number of
the available tools, their uses, and the genome assembly/gene model version they
presently employ (Table 4). Ideally, the most recent gene models should be used
since these represent the most accurate predicted protein sequences. However,
many tools offering unique modes of analysis utilize legacy gene model versions,
and model generation conversion is necessary.
4 Outlook and Future Directions
4.1 Integrative Approaches to Analysis
Since it is unlikely that a single genome-wide technique will definitively enable

function to be assigned to proteins, a key concept of functional genomics is the need
to assimilate and exploit each piece of evidence relating to any given gene to
generate function inferences. As more compatible inferences are made, confidence
is gained and function predictions can be made. These predictions can be experi-
mentally tested by applying appropriate targeted genetic and/or biochemical ana-
lysis to generate “gold-standard” annotations. As new global datasets are generated
and newer technologies (for instance, Chip-Seq or ribosome profiling) are applied,
the integration of data becomes increasingly powerful, as the likelihood of any

given gene displaying differential behavior relative to background increases. In any
case, analysis of datasets in isolation may result in incorrect conclusions due to
potential false positives and negatives. Consequently an integrative approach to
analysis is important (Vidal 2001; Ge et al. 2003; Joyce and Palsson 2006) although
the inherent difficulties in integrating datasets have also been highlighted (Palsson
and Zengler 2010). Specifically, although large-scale repositories exist for specific
data types [such as SRA and GEO (Edgar et al. 2002; Leinonen et al. 2011)], no
system is in place for depositing all datasets. Furthermore experimental variables,
such as precise genotypes, lighting conditions, media recipes, and temperature, are
likely to vary to a greater or lesser extent between studies even when performed
within the same laboratory. Stringent record keeping and documentation of experi-
mental conditions are therefore critical but can be overlooked.
Several online tools catering to Chlamydomonas do present multiple data types
(Table 4), in particular, expression and co-expression data coupled with genomics.
Additional integration of datasets, including proteomes, phenotype, and other
genome-wide studies, will aid these analyses. More recently, big-data approaches
are being considered to deploy machine learning techniques to gain maximal know-
ledge from datasets (Ma et al. 2014).
4.2 Comparative Algal Genomics
Recently, two C. reinhardtii genome comparison studies have offered an appreci-

ation for genome diversity of both commonly used laboratory strains and natural
variation in wild isolates (Flowers et al. 2015; Gallaher et al. 2015). Both investi-
gations compared their re-sequenced genomes to the published reference genome of
strain CC-503 and identified significant genotypic diversity between strains.
Although the relatively small number of strains analyzed in these two investigations
prevented GWAS-style linkage of genotype to phenotype, a combination of
sequencing more genomes, for example, of field isolates, and phenomics
approaches of all sequenced strains may help to elucidate these relations. As
more Chlamydomonas genomes become available, the quality of their assembly
and critically gene model accuracy improve, and -omic methods are applied to
them, the ability to confidently apply the principles outlined herein becomes more
powerful.
Algae comprise a large, diverse group of organisms. Although Chlamydomonas
remains by far the most studied and the most “genomically advanced,” a growing
number of algal genomes are now available enabling genomes to be interpreted
comparatively. Logically, where clear orthologs exist between organisms, indicat-
ing vertical evolutionary descent, functional inferences and annotations can be
legitimately transferred with higher confidence than simple similarity-based
methods. Furthermore, this data transfer can be contextualized by the lifestyle,
growth requirements, and habitat of the respective organisms as well as by experi-

mentally gathered data.
It is important to note that application of the approaches discussed here only
provides functional inferences and that experimental validation is crucial to be
certain of such inferences and should be considered a requisite before very high
confidence (i.e., gold-standard) annotations can be applied. Experimental proce-
dures available in the Chlamydomonas molecular toolbox for performing this next
step have been reviewed recently (Jinkerson and Jonikas 2015; Mussgnug 2015).
Acknowledgments IKB and CEB-H are supported by the Office of Biological and Environmental
Research of the Department Of Energy.
References
Alfred SE, Surendra A, Le C, Lin K, Mok A, Wallace IM, Proctor M, Urbanus ML, Giaever G,
Nislow C (2012) A phenotypic screening platform to identify small molecule modulators of
Chlamydomonas reinhardtii growth, motility and photosynthesis. Genome Biol 13:R105
Allmer J, Naumann B, Markert C, Zhang M, Hippler M (2006) Mass spectrometric genomic data
mining: novel insights into bioenergetic pathways in Chlamydomonas reinhardtii. Proteomics
6:6207–6220
Alonso JM, Stepanova AN, Leisse TJ, Kim CJ, Chen H, Shinn P, Stevenson DK, Zimmerman J,
Barajas P, Cheuk R, Gadrinab C, Heller C, Jeske A, Koesema E, Meyers CC, Parker H,
Prednis L, Ansari Y, Choy N, Deen H, Geralt M, Hazari N, Hom E, Karnes M, Mulholland C,
Ndubaku R, Schmidt I, Guzman P, Aguilar-Henonin L, Schmid M, Weigel D, Carter DE,
Marchand T, Risseeuw E, Brogden D, Zeko A, Crosby WL, Berry CC, Ecker JR (2003)
Genome-wide insertional mutagenesis of Arabidopsis thaliana. Science 301:653–657
Altschul SF, Gish W, Miller W, Myers EW, Lipman DJ (1990) Basic local alignment search tool.
J Mol Biol 215:403–410
Altschul SF, Madden TL, Schäffer AA, Zhang J, Zhang Z, Miller W, Lipman DJ (1997)
Gapped BLAST and PSI-BLAST: a new generation of protein database search programs.
Nucleic Acids Res 25:3389–3402
Aoki Y, Okamura Y, Ohta H, Kinoshita K, Obayashi T (2016) ALCOdb: gene coexpression data-
base for microalgae. Plant Cell Physiol 57:e3
Asamizu E, Nakamura Y, Miura K, Fukuzawa H, Fujiwara S, Hirono M, Iwamoto K, Matsuda Y,
Minagawa J, Shimogawara K, Takahashi Y, Tabata S (2004) Establishment of publicly avail-
able cDNA material and information resource of Chlamydomonas reinhardtii (Chlorophyta) to
facilitate gene function analysis. Phycologia 43:722–726
Atteia A, Adrait A, Brugière S, Tardif M, van Lis R, Deusch O, Dagan T, Kuhn L, Gontero B,
Martin W, Garin J, Joyard J, Rolland N (2009) A proteomic survey of Chlamydomonas rein-
hardtii mitochondria sheds new light on the metabolic plasticity of the organelle and on the
nature of the alpha-proteobacterial mitochondrial ancestor. Mol Biol Evol 26:1533–1548
Baba T, Ara T, Hasegawa M, Takai Y, Okumura Y, Baba M, Datsenko KA, Tomita M, Wanner BL,
Mori H (2006) Construction of Escherichia coli K-12 in-frame, single-gene knockout mutants:
the Keio collection. Mol Syst Biol 2:2006.0008
Bienvenut WV, Espagne C, Martinez A, Majeran W, Valot B, Zivy M, Vallon O, Adam Z,
Meinnel T, Giglione C (2011) Dynamics of post-translational modifications and protein stabil-
ity in the stroma of Chlamydomonas reinhardtii chloroplasts. Proteomics 11:1734–1750
Blaby IK, Blaby-Haas CE, Tourasse N, Hom EF, Lopez D, Aksoy M, Grossman A, Umen J,
Dutcher S, Porter M, King S, Witman GB, Stanke M, Harris EH, Goodstein D, Grimwood J,
Schmutz J, Vallon O, Merchant SS, Prochnik S (2014) The Chlamydomonas genome project:
a decade on. Trends Plant Sci 19:672–680
Bork P, Ouzounis C, Sander C, Scharf M, Schneider R, Sonnhammer E (1992a) What’s in a genome?
Nature 358:287
Bork P, Ouzounis C, Sander C, Scharf M, Schneider R, Sonnhammer E (1992b) Compre-
hensive sequence analysis of the 182 predicted open reading frames of yeast chromosome III.
Protein Sci 1:1677–1690
Boyle NR, Page MD, Liu B, Blaby IK, Casero D, Kropat J, Cokus S, Hong-Hermesdorf A, Shaw J,
Karpowicz SJ, Gallaher S, Johnson S, Benning C, Pellegrini M, Grossman A, Merchant SS
(2012) Three acyltransferases and a nitrogen responsive regulator are implicated in
nitrogen starvation-induced triacylglycerol accumulation in Chlamydomonas. J Biol Chem
287:15811–15825
Carpenter AE, Sabatini DM (2004) Systematic genome-wide screens of gene function. Nat Rev
Genet 5:11–22
Castruita M, Casero D, Karpowicz SJ, Kropat J, Vieler A, Hsieh SI, Yan W, Cokus S, Loo JA,
Benning C, Pellegrini M, Merchant SS (2011) Systems biology approach in Chlamydomonas
reveals connections between copper nutrition and multiple metabolic steps. Plant Cell 23(4):
1273–1292
Cross FR (2015) Tying down loose ends in the chlamydomonas genome: functional significance of
abundant upstream open reading frames. G3 (Bethesda) 6(2):435–446
Dent RM, Sharifi MN, Malnoë A, Haglund C, Calderon RH, Wakao S, Niyogi KK (2015) Large-
scale insertional mutagenesis of Chlamydomonas supports phylogenomic functional prediction
of photosynthetic genes and analysis of classical acetate-requiring mutants. Plant J 82:337–351
Diener DR, Lupetti P, Rosenbaum JL (2015) Proteomic analysis of isolated ciliary transition zones
reveals the presence of ESCRT proteins. Curr Biol 25:379–384
Ding J, Li X, Hu H (2012) Systematic prediction of cis-regulatory elements in the Chlamydomonas
reinhardtii genome using comparative genomics. Plant Physiol 160:613–623
Duvick J, Fu A, Muppirala U, Sabharwal M, Wilkerson MD, Lawrence CJ, Lushbough C,
Brendel V (2008) PlantGDB: a resource for comparative plant genomics. Nucleic Acids Res
36:D959–D965
Eberhard S, Jain M, Im CS, Pollock S, Shrager J, Lin Y, Peek AS, Grossman AR (2006) Generation of
an oligonucleotide array for analysis of gene expression in Chlamydomonas reinhardtii.
Curr Genet 49:106–124
Edgar R, Domrachev M, Lash AE (2002) Gene expression omnibus: NCBI gene expression and
hybridization array data repository. Nucleic Acids Res 30:207–210
Eitzinger N, Wagner V, Weisheit W, Geimer S, Boness D, Kreimer G, Mittag M (2015)
Proteomic analysis of a fraction with intact eyespots of Chlamydomonas reinhardtii and
assignment of protein methylation. Front Plant Sci 6:1085
Fleischmann RD, Adams MD, White O, Clayton RA, Kirkness EF, Kerlavage AR, Bult CJ,
Tomb JF, Dougherty BA, Merrick JM (1995) Whole-genome random sequencing and assem-
bly of Haemophilus influenzae Rd. Science 269:496–512
Flowers JM, Hazzouri KM, Pham GM, Rosas U, Bahmani T, Khraiwesh B, Nelson DR, Jijakli K,
Abdrabu R, Harris EH, Lefebvre PA, Hom EF, Salehi-Ashtiani K, Purugganan MD (2015)
Whole-genome resequencing reveals extensive natural variation in the model green alga Chla-
mydomonas reinhardtii. Plant Cell 27:2353–2369
Gallaher SD, Fitz-Gibbon ST, Glaesener AG, Pellegrini M, Merchant SS (2015) Chlamydomonas
genome resource for laboratory strains reveals a mosaic of sequence variation, identifies
true strain histories, and enables strain-specific studies. Plant Cell 27:2335–2352
Ge H, Walhout AJ, Vidal M (2003) Integrating ‘omic’ information: a bridge between genomics
and systems biology. Trends Genet 19:551–560
Goffeau A, Barrell BG, Bussey H, Davis RW, Dujon B, Feldmann H, Galibert F, Hoheisel JD,
Jacq C, Johnston M, Louis EJ, Mewes HW, Murakami Y, Philippsen P, Tettelin H, Oliver SG
(1996) Life with 6000 genes. Science 274(546):563–547
Goodenough U (2015) Historical perspective on Chlamydomonas as a model for basic research:
1950–1970. Plant J 82:365–369
Goodstein DM, Shu S, Howson R, Neupane R, Hayes RD, Fazo J, Mitros T, Dirks W, Hellsten U,
Putnam N, Rokhsar DS (2012) Phytozome: a comparative platform for green plant genomics.
Nucleic Acids Res 40:D1178–D1186
Haas BJ, Delcher AL, Mount SM, Wortman JR, Smith RK, Hannick LI, Maiti R, Ronning CM,
Rusch DB, Town CD, Salzberg SL, White O (2003) Improving the Arabidopsis genome
annotation using maximal transcript alignment assemblies. Nucleic Acids Res 31:5654–5666
Haas BJ, Salzberg SL, Zhu W, Pertea M, Allen JE, Orvis J, White O, Buell CR, Wortman JR
(2008) Automated eukaryotic gene structure annotation using EVidenceModeler and the
Program to Assemble Spliced Alignments. Genome Biol 9:R7
Harris EH (2001) Chlamydomonas as a model organism. Annu Rev Plant Physiol Plant Mol Biol
52:363–406
Harris E (2009) The Chlamydomonas sourcebook, 2nd edn. Academic Press, San Diego, CA
Hieter P, Boguski M (1997) Functional genomics: it’s all how you read it. Science 278:601–602
Holt C, Yandell M (2011) MAKER2: an annotation pipeline and genome-database management
tool for second-generation genome projects. BMC Bioinf 12:491
Hsieh SI, Castruita M, Malasarn D, Urzica E, Erde J, Page MD, Yamasaki H, Casero D,
Pellegrini M, Merchant SS, Loo JA (2013) The proteome of copper, iron, zinc, and manganese
micronutrient deficiency in Chlamydomonas reinhardtii. Mol Cell Proteomics 12:65–86
Im CS, Zhang Z, Shrager J, Chang CW, Grossman AR (2003) Analysis of light and CO(2) regu-
lation in Chlamydomonas reinhardtii using genome-wide approaches. Photosynth Res 75:
111–125
Jin J, Zhang H, Kong L, Gao G, Luo J (2014) PlantTFDB 3.0: a portal for the functional and
evolutionary study of plant transcription factors. Nucleic Acids Res 42:D1182–D1187
Jinkerson RE, Jonikas MC (2015) Molecular techniques to interrogate and edit the Chlamydo-
monas nuclear genome. Plant J 82:393–412
Joyce AR, Palsson B (2006) The model organism as a system: integrating ‘omics’ data sets. Nat Rev
Mol Cell Biol 7:198–210
Kaul S, Koo HL, Jenkins J, Rizzo M, Rooney T, Tallon LJ, Feldblyum T, Nierman W, Benito MI,
Lin X, Town CD (2000) Analysis of the genome sequence of the flowering plant Arabidopsis
thaliana. Nature 408:796–815
Keller LC, Romijn EP, Zamora I, Yates JR, Marshall WF (2005) Proteomic analysis of isolated
chlamydomonas centrioles reveals orthologs of ciliary-disease genes. Curr Biol 15:1090–1098
Kent WJ, Sugnet CW, Furey TS, Roskin KM, Pringle TH, Zahler AM, Haussler D (2002)
The human genome browser at UCSC. Genome Res 12:996–1006
Kleessen S, Irgang S, Klie S, Giavalisco P, Nikoloski Z (2015) Integration of transcriptomics and
metabolomics data specifies the metabolic response of Chlamydomonas to rapamycin treat-
ment. Plant J 81:822–835
Kwan AL, Li L, Kulp DC, Dutcher SK, Stormo GD (2009) Improving gene-finding in Chlamydo-
monas reinhardtii: GreenGenie2. BMC Genomics 10:210
Labadorf A, Link A, Rogers MF, Thomas J, Reddy AS, Ben-Hur A (2010) Genome-wide analysis
of alternative splicing in Chlamydomonas reinhardtii. BMC Genomics 11:114
Ledford HK, Baroli I, Shin JW, Fischer BB, Eggen RI, Niyogi KK (2004) Comparative profiling of
lipid-soluble antioxidants and transcripts reveals two phases of photo-oxidative stress in a
xanthophyll-deficient mutant of Chlamydomonas reinhardtii. Mol Gen Genomics 272:
470–479
Légeret B, Schulz-Raffelt M, Nguyen HM, Auroy P, Beisson F, Peltier G, Blanc G, Li-Beisson Y
(2016) Lipidomic and transcriptomic analyses of Chlamydomonas reinhardtii under heat stress
unveil a direct route for the conversion of membrane lipids into storage lipids. Plant Cell
Environ 39:834–847
Leinonen R, Sugawara H, Shumway M, Collaboration, I.N.S.D. (2011) The sequence read archive.
Li X, Zhang R, Patena W, Gang SS, Blum SR, Ivanova N, Yue R, Robertson JM, Lefebvre P,
Fitz-Gibbon ST, Grossman AR, Jonikas MC (2016) An indexed, mapped mutant library
enables reverse genetics studies of biological processes in Chlamydomonas reinhardtii.
Plant Cell 28(2):367–387
Lilly JW, Maul JE, Stern DB (2002) The Chlamydomonas reinhardtii organellar genomes respond
transcriptionally and post-transcriptionally to abiotic stimuli. Plant Cell 14:2681–2706
Lohse M, Nagel A, Herter T, May P, Schroda M, Zrenner R, Tohge T, Fernie AR, Stitt M, Usadel B
(2014) Mercator: a fast and simple web server for genome scale functional annotation of
plant sequence data. Plant Cell Environ 37:1250–1258
Lopez D, Casero D, Cokus SJ, Merchant SS, Pellegrini M (2011) Algal functional annotation tool:
a web-based analysis suite to functionally interpret large gene lists using integrated annotation
and expression data. BMC Bioinf 12:282
Ma C, Zhang HH, Wang X (2014) Machine learning for big data analytics in plants. Trends Plant Sci
19:798–808
Malasarn D, Kropat J, Hsieh SI, Finazzi G, Casero D, Loo Ja, Pellegrini M, Wollman F-A,
Merchant SS (2013) Zinc deficiency impacts CO2 assimilation and disrupts copper homeo-
stasis in Chlamydomonas reinhardtii. J Biol Chem 288:10672–10683
May P, Christian JO, Kempa S, Walther D (2009) ChlamyCyc: an integrative systems biology
database and web-portal for Chlamydomonas reinhardtii. BMC Genomics 10:209
Merchant SS, Prochnik SE, Vallon O, Harris EH, Karpowicz SJ, Witman GB, Terry A,
Salamov A, Fritz-Laylin LK, Maréchal-Drouard L, Marshall WF, Qu L-H, Nelson DR,
Sanderfoot AA, Spalding MH, Kapitonov VV, Ren Q, Ferris P, Lindquist E, Shapiro H,
Lucas SM, Grimwood J, Schmutz J, Cardol P, Cerutti H, Chanfreau G, Chen C-L, Cognat V,
Croft MT, Dent R, Dutcher S, Fernández E, Fukuzawa H, González-Ballester D, González-
Halphen D, Hallmann A, Hanikenne M, Hippler M, Inwood W, Jabbari K, Kalanon M,
Kuras R, Lefebvre Pa, Lemaire SD, Lobanov AV, Lohr M, Manuell A, Meier I, Mets L,
Mittag M, Mittelmeier T, Moroney JV, Moseley J, Napoli C, Nedelcu AM, Niyogi K,
Novoselov SV, Paulsen IT, Pazour G, Purton S, Ral J-P, Ria~ no-Pachón DM, Riekhof W,
Rymarquis L, Schroda M, Stern D, Umen J, Willows R, Wilson N, Zimmer SL, Allmer J,
Balk J, Bisova K, Chen C-J, Elias M, Gendler K, Hauser C, Lamb MR, Ledford H, Long JC,
Minagawa J, Page MD, Pan J, Pootakham W, Roje S, Rose A, Stahlberg E, Terauchi AM,
Yang P, Ball S, Bowler C, Dieckmann CL, Gladyshev VN, Green P, Jorgensen R, Mayfield S,
Mueller-Roeber B, Rajamani S, Sayre RT, Brokstein P, Dubchak I, Goodstein D, Hornick L,
Huang YW, Jhaveri J, Luo Y, Martı́nez D, Ngau WCA, Otillar B, Poliakov A, Porter A,
Szajkowski L, Werner G, Zhou K, Grigoriev IV, Rokhsar DS, Grossman AR (2007)
The Chlamydomonas genome reveals the evolution of key animal and plant functions.
Science (New York, NY) 318:245–250
Mettler T, Mühlhaus T, Hemme D, Sch€ ottler MA, Rupprecht J, Idoine A, Veyel D, Pal SK,
Yaneva-Roder L, Winck FV, Sommer F, Vosloh D, Seiwert B, Erban A, Burgos A,
Arvidsson S, Sch€ onfelder S, Arnold A, Günther M, Krause U, Lohse M, Kopka J,
Nikoloski Z, Mueller-Roeber B, Willmitzer L, Bock R, Schroda M, Stitt M (2014) Systems
analysis of the response of photosynthesis, metabolism, and growth to an increase in irradiance
in the photosynthetic model organism Chlamydomonas reinhardtii. Plant Cell 26:2310–2350
Moellering ER, Benning C (2010) RNA interference silencing of a major lipid droplet protein
affects lipid droplet size in Chlamydomonas reinhardtii. Eukaryot Cell 9:97–106
Mussgnug JH (2015) Genetic tools and techniques for Chlamydomonas reinhardtii. Appl Micro-
biol Biotechnol 99:5407–5418
Nguyen HM, Baudet M, Cuiné S, Adriano JM, Barthe D, Billon E, Bruley C, Beisson F, Peltier G,
Ferro M, Li-Beisson Y (2011) Proteomic profiling of oil bodies isolated from the unicellular
green microalga Chlamydomonas reinhardtii: with focus on proteins involved in lipid meta-
bolism. Proteomics 11:4266–4273
Niehrs C, Pollet N (1999) Synexpression groups in eukaryotes. Nature 402:483–487
Overbeek R, Begley T, Butler RM, Choudhuri JV, Chuang HY, Cohoon M, de Crécy-Lagard V,
Diaz N, Disz T, Edwards R, Fonstein M, Frank ED, Gerdes S, Glass EM, Goesmann A,
Hanson A, Iwata-Reuyl D, Jensen R, Jamshidi N, Krause L, Kubal M, Larsen N, Linke B,
McHardy AC, Meyer F, Neuweger H, Olsen G, Olson R, Osterman A, Portnoy V, Pusch GD,
Rodionov DA, Rückert C, Steiner J, Stevens R, Thiele I, Vassieva O, Ye Y, Zagnitko O,
Vonstein V (2005) The subsystems approach to genome annotation and its use in the project to
annotate 1000 genomes. Nucleic Acids Res 33:5691–5702
Palsson B, Zengler K (2010) The challenges of integrating multi-omic data sets. Nat Chem Biol 6:
787–789
Park JJ, Wang H, Gargouri M, Deshpande RR, Skepper JN, Holguin FO, Juergens MT, Shachar-
Hill Y, Hicks LM, Gang DR (2015) The response of Chlamydomonas reinhardtii to
nitrogen deprivation: a systems biology analysis. Plant J 81:611–624
Pazour GJ, Agrin N, Leszyk J, Witman GB (2005) Proteomic analysis of a eukaryotic cilium. J Cell
Biol 170:103–113
Pérez-Rodrı́guez P, Ria~no-Pachón DM, Corrêa LG, Rensing SA, Kersten B, Mueller-Roeber B
(2010) PlnTFDB: updated content and new features of the plant transcription factor database.
Prochnik SE, Umen J, Nedelcu AM, Hallmann A, Miller SM, Nishii I, Ferris P, Kuo A, Mitros T,
Fritz-Laylin LK, Hellsten U, Chapman J, Simakov O, Rensing SA, Terry A, Pangilinan J,
Kapitonov V, Jurka J, Salamov A, Shapiro H, Schmutz J, Grimwood J, Lindquist E, Lucas S,
Grigoriev IV, Schmitt R, Kirk D, Rokhsar DS (2010) Genomic analysis of organismal com-
plexity in the multicellular green alga Volvox carteri. Science 329:223–226
Rhee SY, Wood V, Dolinski K, Draghici S (2008) Use and misuse of the gene ontology anno-
tations. Nat Rev Genet 9:509–515
Rolland N, Atteia A, Decottignies P, Garin J, Hippler M, Kreimer G, Lemaire SD, Mittag M,
Wagner V (2009) Chlamydomonas proteomics. Curr Opin Microbiol 12:285–291
Romero-Campero FJ, Perez-Hurtado I, Lucas-Reina E, Romero JM, Valverde F (2016)
ChlamyNET: a Chlamydomonas gene co-expression network reveals global properties of the
transcriptome and the early setup of key co-expression patterns in the green lineage.
BMC Genomics 17:227
Rymarquis LA, Handley JM, Thomas M, Stern DB (2005) Beyond complementation. Map-based
cloning in Chlamydomonas reinhardtii. Plant Physiol 137:557–566
Schmidt M, Gessner G, Luff M, Heiland I, Wagner V, Kaminski M, Geimer S, Eitzinger N,
Reissenweber T, Voytsekh O, Fiedler M, Mittag M, Kreimer G (2006) Proteomic analysis of
the eyespot of Chlamydomonas reinhardtii provides novel insights into its components and
tactic movements. Plant Cell 18:1908–1930
Schmollinger S, Mühlhaus T, Boyle NR, Blaby IK, Casero D, Mettler T, Moseley JL, Kropat J,
Sommer F, Strenkert D, Hemme D, Pellegrini M, Grossman AR, Stitt M, Schroda M,
Merchant SS (2014) Nitrogen-sparing mechanisms in Chlamydomonas affect the tran-
scriptome, the proteome, and photosynthetic metabolism. Plant Cell 26(4):1410–1435
Schnoes AM, Brown SD, Dodevski I, Babbitt PC (2009) Annotation error in public databases:
misannotation of molecular function in enzyme superfamilies. PLoS Comput Biol 5:e1000605
Seaver SM, Gerdes S, Frelin O, Lerma-Ortiz C, Bradbury LM, Zallot R, Hasnain G, Niehaus TD,
El Yacoubi B, Pasternak S, Olson R, Pusch G, Overbeek R, Stevens R, de Crécy-Lagard V,
Ware D, Hanson AD, Henry CS (2014) High-throughput comparison, functional annotation,
and metabolic modeling of plant genomes using the PlantSEED resource. Proc Natl Acad Sci
U S A 111:9645–9650
Specht M, Stanke M, Terashima M, Naumann-Busch B, Janssen I, H€ ohner R, Hom EF, Liang C,
Hippler M (2011) Concerted action of the new Genomic Peptide Finder and AUGUSTUS
allows for automated proteogenomic annotation of the Chlamydomonas reinhardtii genome.

Proteomics 11:1814–1823
Stanke M, Diekhans M, Baertsch R, Haussler D (2008) Using native and syntenically mapped
cDNA alignments to improve de novo gene finding. Bioinformatics 24:637–644
Stolc V, Samanta MP, Tongprasit W, Marshall WF (2005) Genome-wide transcriptional analysis
of flagellar regeneration in Chlamydomonas reinhardtii identifies orthologs of ciliary disease
genes. Proc Natl Acad Sci U S A 102:3703–3707
Subramanian V, Dubini A, Astling DP, Laurens LM, Old WM, Grossman AR, Posewitz MC,
Seibert M (2014) Profiling Chlamydomonas metabolism under dark, anoxic H2-producing
conditions using a combined proteomic, transcriptomic, and metabolomic approach. J Prote-
ome Res 13:5431–5451
Tardif M, Atteia A, Specht M, Cogne G, Rolland N, Brugière S, Hippler M, Ferro M, Bruley C,
Peltier G, Vallon O, Cournac L (2012) PredAlgo: a new subcellular localization prediction tool
dedicated to green algae. Mol Biol Evol 29:3625–3639
Terashima M, Specht M, Naumann B, Hippler M (2010) Characterizing the anaerobic response of
Chlamydomonas reinhardtii by quantitative proteomics. Mol Cell Proteomics 9:1514–1532
Terashima M, Specht M, Hippler M (2011) The chloroplast proteome: a survey from the Chla-
mydomonas reinhardtii perspective with a focus on distinctive features. Curr Genet 57:
151–168
Thimm O, Bläsing O, Gibon Y, Nagel A, Meyer S, Krüger P, Selbig J, Müller La, Rhee SY, Stitt M
(2004) Mapman: a user-driven tool to display genomics data sets onto diagrams of meta-
bolic pathways and other biological processes. Plant J 37:914–939
Tian W, Skolnick J (2003) How well is enzyme function conserved as a function of pair-
wise sequence identity? J Mol Biol 333:863–882
Tulin F, Cross F (2015) Patching holes in the Chlamydomonas genome (bioRxiv)
Urzica EI, Casero D, Yamasaki H, Hsieh SI, Adler LN, Karpowicz SJ, Blaby-Haas CE, Clarke SG,
Loo JA, Pellegrini M, Merchant SS (2012) Systems and trans-system level analysis identifies
conserved iron deficiency responses in the plant lineage. Plant Cell 24(10):3921–3948
Van Verk MC, Hickman R, Pieterse CM, Van Wees SC (2013) RNA-Seq: revelation of the
messengers. Trends Plant Sci 18:175–179
Vandepoele K, Van Bel M, Richard G, Van Landeghem S, Verhelst B, Moreau H, Van de Peer Y,
Grimsley N, Piganeau G (2013) Pico-PLAZA, a genome database of microbial photosynthetic
eukaryotes. Environ Microbiol 15:2147–2153
Vidal M (2001) A biological atlas of functional maps. Cell 104:333–339
Wagner V, Ullmann K, Mollwo A, Kaminski M, Mittag M, Kreimer G (2008) The phospho-
proteome of a Chlamydomonas reinhardtii eyespot fraction includes key proteins of the
light signaling pathway. Plant Physiol 146:772–788
Wakao S, Chin BL, Ledford HK, Dent RM, Casero D, Pellegrini M, Merchant SS, Niyogi KK
(2014) Phosphoprotein SAK1 is a regulator of acclimation to singlet oxygen in Chlamydo-
monas reinhardtii. elife 3:e02286
Waterston RH, Lindblad-Toh K, Birney E, Rogers J, Abril JF, Agarwal P, Agarwala R,
Ainscough R, Alexandersson M, An P, Antonarakis SE, Attwood J, Baertsch R, Bailey J,
Barlow K, Beck S, Berry E, Birren B, Bloom T, Bork P, Botcherby M, Bray N, Brent MR,
Brown DG, Brown SD, Bult C, Burton J, Butler J, Campbell RD, Carninci P, Cawley S,
Chiaromonte F, Chinwalla AT, Church DM, Clamp M, Clee C, Collins FS, Cook LL, Copley
RR, Coulson A, Couronne O, Cuff J, Curwen V, Cutts T, Daly M, David R, Davies J,
Delehaunty KD, Deri J, Dermitzakis ET, Dewey C, Dickens NJ, Diekhans M, Dodge S,
Dubchak I, Dunn DM, Eddy SR, Elnitski L, Emes RD, Eswara P, Eyras E, Felsenfeld A,
Fewell GA, Flicek P, Foley K, Frankel WN, Fulton LA, Fulton RS, Furey TS, Gage D, Gibbs
RA, Glusman G, Gnerre S, Goldman N, Goodstadt L, Grafham D, Graves TA, Green ED,
Gregory S, Guigó R, Guyer M, Hardison RC, Haussler D, Hayashizaki Y, Hillier LW,
Hinrichs A, Hlavina W, Holzer T, Hsu F, Hua A, Hubbard T, Hunt A, Jackson I, Jaffe DB,
Johnson LS, Jones M, Jones TA, Joy A, Kamal M, Karlsson EK, Karolchik D, Kasprzyk A,
Kawai J, Keibler E, Kells C, Kent WJ, Kirby A, Kolbe DL, Korf I, Kucherlapati RS, Kulbokas
EJ, Kulp D, Landers T, Leger JP, Leonard S, Letunic I, Levine R, Li J, Li M, Lloyd C, Lucas S,
Ma B, Maglott DR, Mardis ER, Matthews L, Mauceli E, Mayer JH, McCarthy M, McCombie
WR, McLaren S, McLay K, McPherson JD, Meldrim J, Meredith B, Mesirov JP, Miller W,
Miner TL, Mongin E, Montgomery KT, Morgan M, Mott R, Mullikin JC, Muzny DM, Nash
WE, Nelson JO, Nhan MN, Nicol R, Ning Z, Nusbaum C, O’Connor MJ, Okazaki Y, Oliver K,
Overton-Larty E, Pachter L, Parra G, Pepin KH, Peterson J, Pevzner P, Plumb R, Pohl CS,
Poliakov A, Ponce TC, Ponting CP, Potter S, Quail M, Reymond A, Roe BA, Roskin KM,
Rubin EM, Rust AG, Santos R, Sapojnikov V, Schultz B, Schultz J, Schwartz MS, Schwartz S,
Scott C, Seaman S, Searle S, Sharpe T, Sheridan A, Shownkeen R, Sims S, Singer JB, Slater G,
Smit A, Smith DR, Spencer B, Stabenau A, Stange-Thomann N, Sugnet C, Suyama M,
Tesler G, Thompson J, Torrents D, Trevaskis E, Tromp J, Ucla C, Ureta-Vidal A, Vinson JP,
Von Niederhausern AC, Wade CM, Wall M, Weber RJ, Weiss RB, Wendl MC, West AP,
Wetterstrand K, Wheeler R, Whelan S, Wierzbowski J, Willey D, Williams S, Wilson RK,
Winter E, Worley KC, Wyman D, Yang S, Yang SP, Zdobnov EM, Zody MC, Lander ES,
Consortium MGS (2002) Initial sequencing and comparative analysis of the mouse genome.
Nature 420:520–562
Winck FV, Ria~no-Pachón DM, Sommer F, Rupprecht J, Mueller-Roeber B (2012) The nuclear
proteome of the green alga Chlamydomonas reinhardtii. Proteomics 12:95–100
Winzeler EA, Shoemaker DD, Astromoff A, Liang H, Anderson K, Andre B, Bangham R, Benito R,
Boeke JD, Bussey H, Chu AM, Connelly C, Davis K, Dietrich F, Dow SW, El Bakkoury M,
Foury F, Friend SH, Gentalen E, Giaever G, Hegemann JH, Jones T, Laub M, Liao H,
Liebundguth N, Lockhart DJ, Lucau-Danila A, Lussier M, M’Rabet N, Menard P,
Mittmann M, Pai C, Rebischung C, Revuelta JL, Riles L, Roberts CJ, Ross-MacDonald P,
Scherens B, Snyder M, Sookhai-Mahadeo S, Storms RK, Véronneau S, Voet M, Volckaert G,
Ward TR, Wysocki R, Yen GS, Yu K, Zimmermann K, Philippsen P, Johnston M, Davis RW
(1999) Functional characterization of the S. cerevisiae genome by gene deletion and
parallel analysis. Science 285:901–906
Zhang Z, Shrager J, Jain M, Chang CW, Vallon O, Grossman AR (2004) Insights into the sur-
vival of Chlamydomonas reinhardtii during sulfur starvation based on microarray analysis of
gene expression. Eukaryot Cell 3:1331–1348
Zheng HQ, Chiang-Hsieh YF, Chien CH, Hsu BK, Liu TL, Chen CN, Chang WC (2014)
AlgaePath: comprehensive analysis of metabolic pathways using transcript abundance data
from next-generation sequencing in green algae. BMC Genomics 15:196
Zones JM, Blaby IK, Merchant SS, Umen JG (2015) High-resolution profiling of a synchron-
ized diurnal transcriptome from Chlamydomonas reinhardtii reveals continuous cell and meta-
bolic differentiation. Plant Cell 27:2743–2769
Nuclear Transformation and Toolbox
Development
Jan H. Mussgnug
Abstract More than 99% of all genes of C. reinhardtii are encoded in the nuclear
DNA. Over the past decades, classical genetic techniques and molecular biological
strategies have been established that allow manipulation of the nuclear DNA for
fundamental research and applied tasks. The nuclear genome is haploid during the
vegetative stage of the green microalga’s life cycle, a feature promoting the eluci-
dation of specific genotype–phenotype interrelations in genetic studies. Supported
by the general progress of molecular technologies, the toolbox for C. reinhardtii
nuclear genome transformation and engineering has been greatly expanded, and,
today, a substantial arsenal of tools and techniques is available which can be utilized
to approach individual molecular research tasks.
Several important aspects of nuclear genetic engineering with C. reinhardtii will
be addressed in this chapter. Since in many cases, the prerequisite for genetic
engineering is the transformation of DNA, strategies for nuclear DNA delivery
will be introduced within the historical context. Furthermore, established DNA
elements, transformation selection markers, strategies to achieve modulation of
gene expression, and examples of versatile vectors will be summarized. Finally, cell
line-specific considerations will be addressed before future perspectives are
presented.
1 Introduction
Eukaryotic C. reinhardtii microalgae store DNA, the basic chemical compound

comprising the cells’ genetic information, in three types of organelles: nuclei,
chloroplasts, and mitochondria. Efficient techniques for stable DNA transformation
have been established for all three genomes some 25 years ago; therefore, all three
compartments are easily accessible for genetic engineering today.
By far most of the approximately 19,500 predicted protein-coding transcripts
(including splice variants) originate from the cell nucleus (Joint Genome Institute
J.H. Mussgnug (*)

Faculty of Biology, Center for Biotechnology (CeBiTec), Bielefeld University,
Universitätsstrasse 27, 33615 Bielefeld, Germany

28 J.H. Mussgnug
2015). Here, the genetic information is stored as DNA, eventually transcribed into
RNA and, in the case of protein-coding genes, decoded in the cytosol to guide
formation of protein macromolecules. These functional units are then individually
distributed to the compartments of the microalgal cell and participate in regulating
life functions.
The very first successful DNA transformation of C. reinhardtii was published in
the year 1982 (Rochaix and van Dillewijn 1982), and since then, the development
and utilization of a versatile toolbox for genetic engineering has been a major focus
of molecular biologists working with this model organism. Genetic engineering
strategies have greatly been aided by the fast technical progress related to DNA
sequencing, DNA synthesis, bioinformatics, and chemical component analysis over
the last decades. Many regulatory genetic elements promoting stable transgene
(TG) expression are known today, and, furthermore, regulatory sequences have
been identified that allow modulated TG expression for more complex gene expres-
sion trials.
Several positive and negative transformation markers allow fast and easy selec-
tion of successfully transformed algal cells. Depending on the individual TG and
the host cell line, however, nuclear gene expression can still be challenging, and the
efficiency has to be evaluated on a case-by-case basis.
2 Methods for Nuclear DNA Transformation
Stable integration of recombinant DNA into the nuclear genome is well established,
and three methods are commonly used to achieve DNA transfer: biolistic particle
bombardment, vortexing in the presence of small particles, and electroporation. The
choice of the preferred method mainly depends on the parental cell line characteris-
tics, especially on the presence or absence of an outer cell wall, and potential
constraints with respect to the available laboratory equipment. In addition to the
three main methods, T-DNA transformation mediated by Agrobacterium tumefaciens
was described to be possible as well (Kumar et al. 2004) but does not seem to be
commonly applied. Micro- and nanoinjection (Nichols and Rikmenspoel 1978;
Hennig et al. 2015) could also be feasible methods but apparently have not yet
been applied for stable transfer of nucleic acid into C. reinhardtii cells. Since it has
been shown that the efficiency of DNA transformation was increased when vector
sequences were omitted from nuclear transformation setups (Meslet-Cladiere and
Vallon 2011), it is reasonable to recommend avoiding unnecessary DNA regions
from transformation experiments.
Nuclear Transformation and Toolbox Development 29
2.1 Biolistic Transformation
Biolistic particle bombardment of plant cells was first demonstrated by Klein et al.
(1987), who used a particle gun to deliver tungsten particles previously coated with
nucleic acids (DNA or RNA) into onion (Allium cepa) cell tissue (Klein et al. 1987).
In the following year, this technique was successfully applied to achieve the first
stable and efficient DNA transformation of C. reinhardtii cells. Since codon
optimized and reliable dominant selectable markers promoting antibiotic resistance
were not yet established, most initial trials relied on transformation of photosyn-
thetic or auxotrophic Chlamydomonas mutants with the respective endogenous
genes to restore photosynthetic competence or nutrient prototrophy, respectively.
Boynton et al. (1988) were the first to succeed with this strategy by restoring an
atpB-deficient chloroplast mutant (Boynton et al. 1988), a method later also applied
to introduce embedded foreign genes (Blowers et al. 1989).
Shortly thereafter, several examples of successful biolistic transformation of the
nuclear genome followed. For nuclear transformants selection, Debuchy et al. (1989)
used the argininosuccinate lyase gene (ARG7), whereas Kindle et al. (1989) chose the
nitrate reductase gene (NIT1) to restore the corresponding nuclear mutant cell lines
(Debuchy et al. 1989; Kindle et al. 1989). In a related work, it was shown that DNA
co-transformation into the nuclear genome was also possible with this method (Day
et al. 1990). The presence of a wild-type (wt) cell wall does not prevent biolistic DNA
transformation, and nonhomologous insertion of the transformed DNA at apparently
random loci is far more common than integration by homologous recombination. An
early work estimated a ratio of 24:1 (random vs. homologous events) (Sodeinde and
Kindle 1993), but more recent work indicates an even higher ratio in favor of random
integration (Zorin et al. 2005).
2.2 Agitation of Cells in the Presence of DNA

and Microparticles
A disadvantage of the biolistic method is that sample preparation is quite time-

consuming, and comparably sophisticated technical equipment is necessary. Karen
L. Kindle therefore adopted an alternative method, which had been established for
yeast before, with great success to generate nuclear transformants cheaply and
efficiently (Kindle 1990). This method, often referred to as “glass bead transfor-
mation,” relies on agitation of C. reinhardtii cells in the presence of DNA and small
(diameter of ca. 0.5 mm) glass beads. Polyethylene glycol (PEG) can be added to
increase the transformation efficiency, and as an alternative to glass beads, silicon
carbide whiskers have also been used (Dunahay 1993). The hydroxyproline-rich
outer wt cell wall inhibits DNA uptake, so it has to be removed via autolysin
treatment before agitation, or, alternatively, a cell wall-deficient cell line can be
used. Despite this constraint, this method is well suited for many research
30 J.H. Mussgnug
applications, and because of its simplicity, it furthermore represents an ideal choice

for teaching environments, e.g., school or university courses.
The overwhelming majority of transformation events occur at random locations, and
a ratio of 1000:1 (nonhomologous vs. homologous events) (Sodeinde and Kindle 1993)
or even less (Gumpel et al. 1994; Nelson and Lefebvre 1995) has been estimated. Zorin
et al. (2005) demonstrated that nonhomologous DNA integration events were more
than 100-fold reduced when single-stranded, instead of double-stranded, DNA was
used, therefore dramatically decreasing the ratio of nonhomologous vs. homologous
events (Zorin et al. 2005). Although the method was further improved by the authors
(Zorin et al. 2009), it still did not gain traction, most likely due to the accompanying
technical difficulties.
2.3 Electroporation
The application of electric impulses for reversible membrane breakdown and stable
DNA transformation was first demonstrated by Neumann and colleagues in 1982,
who successfully used this technique to transfer a herpes simplex thymidine kinase
gene into LTK mouse cells (Neumann et al. 1982). Most likely, the main reason
behind the increased membrane permeability after electric field application is that
aqueous pores are formed, which allow transmembrane molecule transport other-
wise prevented by an intact lipid bilayer (Yarmush et al. 2014).
An advantage of the electroporation method is that it is fast and can be achieved
with rather inexpensive equipment. It therefore has been used to transform many pro-
and eukaryotic species, including Chlamydomonas cell lines, both with and without
an outer cell wall (Brown et al. 1991; Shimogawara et al. 1998). Recently published,
large-scale analyses of nuclear insertions sites after electroporation of cell wall-
deficient C. reinhardtii strain CC-4533 (CMJ030) revealed that DNA insertion occurs
at apparently random loci. Furthermore, sequence evidence suggests that endonu-
cleolytic events can occur during mutagenesis and lead to DNA rearrangements
before integration, resulting in misleading flanking sequence identifications in
subsequent insertion site analyses (Zhang et al. 2014; Li et al. 2016). A notable
feature of the electroporation method is that it can also be applied to introduce
exogenous proteins into C. reinhardtii (Hayashi et al. 2001).
3 Recombinant DNA Expression
Plasmids are most commonly used as vectors for Chlamydomonas nuclear trans-
formation, and some selected examples are presented in a later section of this
chapter. Transformation plasmids usually consist of a cloning vector backbone
and one or more TG inserts. A typical insert comprises promoter/50 UTR, coding
region, and 30 UTR sequences and can contain one or more introns. The regulatory
50 and 30 sequences are often derived from endogenous or foreign genes with high
natural expression levels, including several inducible genes (see Sect. 3.2). If the
TG confers a selectable phenotype, positive transformant identification is straight-
forward. In case the TG does not confer a selectable phenotype, it can be
co-transformed on a second plasmid, be cloned into the selectable vector plasmid
as a separate expression cassette, or it can be fused with a reporter protein. In
addition, viral 2A peptides were recently successfully employed to express
multicistronic transgenes. Importantly, these 2A peptides allow direct coupling of
a gene of interest to a selection marker. By applying this strategy, Rasala et al.
(2012) demonstrated that coupling of xylanase1 with the FMDV 2A peptide
resulted in a 100-fold increase of enzyme activity, compared to the unlinked
control (Rasala et al. 2012). Many combinations of promoter DNA regions, selec-
tion markers, introns, and 30 UTR regions have been generated, and an updated
overview of successfully used vector elements is presented in the following
sections.
3.1 Promoter Elements
Gene expression is dependent on DNA elements which promote binding of the

transcription factors necessary to control initiation of RNA polymerase activity.
Several promoter elements like TATA boxes, initiator (Inr), B recognition (BRE),
and downstream promoter elements (DPE) have been identified in plants (Porto
et al. 2014); however, flexibility of location and sequence variability can make
motif assignment difficult. A genome-wide computational study was performed by
Ding et al. (2012) to identify potential cis-regulatory elements within the nuclear
genome of C. reinhardtii. In this work, a novel algorithm called MERCED
(“modeling evolution rate across species for cis-regulatory element discovery”)
was applied, predicting a total of 66,530 cis-regulatory elements, corresponding to
317 element motifs (Ding et al. 2012).
Most of the DNA regions used to drive heterologous nuclear gene expression in
Chlamydomonas originate from only very few hosts. An extended list of promoters
is presented in Table 1.
3.2 Modulation of Recombinant DNA Expression
Depending on the goal, modulated or constitutive recombinant gene expression can

be aimed for, and several regulatory elements have been characterized which can
direct gene expression rates.
32 J.H. Mussgnug
Table 1 List of promoters used for recombinant DNA expression in C. reinhardtii from nuclear
genomes
Name Organism, annotation References
ARG7 C. reinhardtii, argininosuccinate Specht et al. (2014)
lyase
ATX1 C. reinhardtii, copper chaperone Fei and Deng (2007)
antioxidant
ß2TUB C. reinhardtii, β2-tubulin Brunke et al. (1984)
C3 C. reinhardtii, C3 Voytsekh et al. (2008)
CAH1 C. reinhardtii, carbonic anhydrase Kucho et al. (1999), Ferrante et al. (2011)
CaMV Cauliflower mosaic virus, 35S Kumar et al. (2004), Guilley et al. (1982),
35S Ruecker et al. (2008)
CHOP2 C. reinhardtii, channelopsin-2 Fuhrmann et al. (2004)
CPX1 C. reinhardtii, Quinn et al. (2003)
coproporphyrinogen oxidase
CYC6 C. reinhardtii, cytochrome c6 Quinn et al. (2003), Ferrante et al. (2011)
FDX5 C. reinhardtii, ferredoxin Lambertz et al. (2010)
FEA1 C. reinhardtii, FEA1 (H43) Baba et al. (2011), Fei et al. (2009)
(H43)
FOX1 C. reinhardtii, multi-copper Deng et al. (2014)
oxidase
FTR1 C. reinhardtii, iron transporter Fei et al. (2010)
GPXH C. reinhardtii, glutathione Leisinger et al. (2001)
(GPX5) peroxidase
HSP70A C. reinhardtii, heat shock factor 1 Schroda et al. (2000)
HSP70A/ C. reinhardtii, hybrid promoter Schroda et al. (2000), Strenkert et al. (2013),
RBCS2 HSP70A/RBCS2 Lodha et al. (2008)
HSP70A/ Volvox carteri, hybrid promoter Hallmann and Wodniok (2006)
RBCS3 HSP70A/RBCS3
HYDA1 C. reinhardtii, [FeFe]-hydrogenase Pape et al. (2012)
isoform1
LHCBM6 C. reinhardtii, LHCBM6 (CABII- Blankenship and Kindle (1992), Hahn and
1, LHCB1) Kück (1999)
LHCBM9 C. reinhardtii, LHCBM9 Grewe et al. (2014), Sawyer et al. (2015)
LIP Dunaliella tertiolecta, light- Park et al. (2013)
inducible protein
METE C. reinhardtii, B12-independent Helliwell et al. (2014), Croft et al. (2005)
methionine synthase
NAB1 C. reinhardtii, nucleic acid- Berger et al. (2014), Mussgnug et al. (2005)
binding protein 1
NIT1 C. reinhardtii, nitrate reductase Ohresser et al. (1997)
nos Agrobacterium tumefaciens, Diaz-Santos et al. (2013), Hall et al. (1993)
nopaline synthase
PSAD C. reinhardtii, photosystem I Fischer and Rochaix (2001)
subunit
RBCS2 C. reinhardtii, RUBISCO small Goldschmidt-Clermont and Rahire (1986),
subunit Kozminski et al. (1993)
(continued)
Table 1 (continued)
Name Organism, annotation References
RBCS2 Dunaliella tertiolecta, RUBISCO Walker et al. (2005)
small subunit
saps Synthetic algal promoters Scranton et al. (2016)
SQD2 C. reinhardtii, Iwai et al. (2014)
sulphoquinovosyltransferase
SV 40 Simian virus 40, early promoter Hasnain et al. (1985), Ladygin and Butanaev
(2002)
Alternative names are indicated in brackets. Table modified from (Mussgnug 2015)
3.2.1 High-Level Transgene Expression
Arguably the most prominent option for high TG expression in Chlamydomonas

currently is the HSP70A/RBCS2 hybrid promoter. This promoter fusion element
was introduced by Schroda et al. (2000), since the HSP70A element was observed
to activate TG-driving promoters located further downstream (Schroda et al. 2000).
Detailed investigations showed that this activating effect is mediated by distinct
cis-regulatory elements within the promoter (TATA-box and heat shock elements),
indicating that associated chromatin structure modulations are responsible for the
observed stimulating effects (Lodha et al. 2008; Strenkert et al. 2013). The
C. reinhardtii ARG7 promoter is another example promoting comparatively high
TG expression capacity, and it was recently demonstrated that the respective 1425
promoter/50 UTR region promotes similar TG expression efficiency as the chimeric
HSP70A/RBCS2 promoter (Specht et al. 2014). Further potentially highly efficient
promoter regions, e.g., derived from the ubiquitin regulatory protein (UBIRP), were
identified in a promoter trapping approach (Vila et al. 2012). Since these novel
promoters have not yet been systematically characterized, it is reasonable to
suggest that additional improvements, e.g., addition of enhancing cis-regulatory
elements, will result in establishment of further improved TG expression vectors. In
this context, Scranton et al. (2016) very recently identified specific cis-motifs
present within native C. reinhardtii promoters of genes with high expression levels
via the POWRS software (Davis et al. 2012). This information was used to generate
a set of novel synthetic algal promoters (saps), and 7 of the 25 investigated saps
were described to promote higher average and maximum reporter gene expression
than the HSP70A/RBCS2 hybrid promoter (Scranton et al. 2016).
3.2.2 Inducible Transgene Expression
For certain target proteins, constitutive high-level expression might not be desir-
able, e.g., in case dose-dependent phenotypes are investigated or if cytotoxic side
effects of the product cannot be excluded. Analyses of individual genes and full
transcriptomes have led to the identification of a great number of transcriptionally
regulated C. reinhardtii genes. Despite this fact, not many tightly controlled
34 J.H. Mussgnug
inducible promoters have been studied thoroughly for versatile recombinant DNA
expression. Three of the prominent examples will briefly be depicted in the follow-
ing paragraphs; however, it should be noted that novel, effective “on/off” promoters
are still in demand.
One of the best characterized inducible genes of Chlamydomonas is cytochrome
c6, for which studies on transcriptional regulation were performed already 25 years
ago (Merchant et al. 1991). Since then, it was demonstrated that the respective
promoter is silenced if copper is present, but transcription is strongly induced if
copper is completely absent or upon nickel addition (Quinn et al. 2003). A 428 bp
promoter sequence was subsequently used to build a versatile system for inducible
control of chloroplast genes (Surzycki et al. 2007), mediated by the factor NAC2
(Nickelsen et al. 1994).
The nitrate reductase NIT1 represents another strongly inducible C. reinhardtii
gene, and the promoter region has been studied in recombinant setups for many
years (Zhang and Lefebvre 1997). Here, transcription is repressed in the presence of
ammonium and induced when ammonium is replaced by nitrate. The NIT1 pro-
moter was used for inducible transcript silencing via RNAi (Koblenz and Lechtreck
2005), and a 791 bp 50 sequence was subsequently used to create a versatile
inducible microRNA expression system (Schmollinger et al. 2010). Interestingly,
the NIT1 promoter was also tested in the work of Surzycki et al. but was found not
to be effective in their setup (Surzycki et al. 2007).
The methionine synthase gene METE was shown to be repressed in the presence
of vitamin B12 (Croft et al. 2005), and Ramundo et al. used a 1213 bp region
upstream of this gene as an inducible promoter for a vitamin-controlled expression/
repression system for chloroplast genes (Ramundo et al. 2013). They found,
however, that complete silencing of gene expression could not be achieved via
vitamin B12 addition alone but was only possible via the additional activity of the
thiamine pyrophosphate-responsive riboswitch THI4 (Ramundo et al. 2013). This
riboswitch was originally identified by Croft and colleagues in the 50 UTR of the
THI4 gene and shown to regulate thiamine biosynthesis in vivo (Croft et al. 2007).
Since effective, inducible riboswitches can evidently be found in the C. reinhardtii
genome, it is possible that the discovery of additional riboswitches will lead to the
development of further, independent options to modulate recombinant TG expres-
sion in the future.
3.3 Introns
In addition to the aforementioned cis-regulatory promoter elements located

upstream of the TG coding region, enhancing elements present within endogenous
introns have also been identified. The general relevance of introns is reflected by the
fact that 92% of the C. reinhardtii genes contain at least one intron (Merchant et al.
2007). The introns of the highly expressed RBCS2 gene were analyzed in detail.
Lumbreras and colleagues demonstrated that the RBCS2 intron 1 enhances TG
expression and that this effect is not dependent on the orientation or localization
relative to the promoter of the TG (Lumbreras et al. 1998). Kovar and colleagues
observed that adequate expression of an engineered ALS protein was dependent on
the presence of the respective set of introns (Kovar et al. 2002). Eichler-Stahlberg
et al. performed a luciferase-based reporter study on the relevance of the individual
RBCS2 introns and demonstrated that highest levels of reporter activity were
obtained when introns 1, 2, and 3 were inserted in the correct order (Eichler-
Stahlberg et al. 2009). Furthermore, preliminary data from a systematic study in
our lab showed that the gene expression can significantly be enhanced by strategical
distribution of multiple RBCS2 introns into a target transgene-coding sequence.
Interestingly, an enhancing effect was not detected for all introns tested, indicating
the presence of specific enhancer elements. These examples clearly show that intron
characteristics of a given target transgene is a factor that should be taken into
account for nuclear gene expression approaches.
3.4 30 UTRs
Shen and colleagues performed a large-scale computational study and showed that
the average length of C. reinhardtii 30 UTRs is 595 nucleotides (with several
extending 1450 nucleotides), which is roughly twice as long as the average
30 UTRs of Arabidopsis thaliana (Shen et al. 2008). Polyadenylation of the 30 ends
of nuclear pre-mRNAs is a crucial step for functional gene expression, and
cis-elements guiding this process can regularly be detected within the 30 UTRs.
Recent bioinformatic (Zhao et al. 2014) and experimental (Bell et al. 2016)
investigations clearly confirmed the earlier notion that (UGUAA) is the dominant
polyadenylation signal for C. reinhardtii nuclear genes. Interestingly, the sequence
data indicated that alternative polyadenylation of nuclear mRNAs can occur (Zhao
et al. 2014), although extend and relevance for functional gene expression are still
under debate (Bell et al. 2016).
With regard to recombinant gene expression approaches, the 30 UTR derived
from the RBCS2 gene was applied most often (Lumbreras et al. 1998; Cerutti et al.
1997); however, many more were successfully used, including the 30 UTRs from
PSAD (Fischer and Rochaix 2001), COP (Sizova et al. 2001), ARS (Davies et al.
1992), and ALS (Kovar et al. 2002). Furthermore, TG expression was demonstrated
to be possible even without inclusion of a defined 30 UTR (Meslet-Cladiere and
Vallon 2011). Enhancement of TG expression via optimization of the respective
30 UTR could be a feasible strategy, but this was not yet investigated systematically.
36 J.H. Mussgnug
3.5 G+C Content
In contrast to the mitochondrial (45% G+C) and chloroplast (35% G+C)

genomes, the nuclear genome of C. reinhardtii is biased toward high-G+C content
(overall 64%, coding sequence 68% G+C content) (Merchant et al. 2007). Since
it was observed that foreign gene expression was poor in many early trials, it was
suggested that important factors for efficient heterologous nuclear gene expression
in C. reinhardtii are G+C content and codon composition of the respective TGs.
Fuhrmann et al. (1999) tested this hypothesis with an Aequorea victoria gene
encoding a GFP protein. An adapted version of the gene was synthesized, which
was composed entirely of codons that are present in naturally well-expressed
Chlamydomonas genes, concomitantly raising the G+C content from 39.5% to
61.6% and thus more closely resembling the average nuclear G+C content. In
contrast to the original gene, the synthetic GFP could be expressed efficiently as
part of fusion proteins, suggesting a positive effect of the codon adjustment
(Fuhrmann et al. 1999). In a similar approach, Heitzer et al. (2007) compared the
expression of AT-rich and GC-rich GFP variants, fused in frame with the BLE
protein marker. As a result, the number of positive transformants and the
transformants’ individual resistances toward the selection reagent zeocin was
significantly higher for the codon optimized variants, indicating more pronounced
gene-silencing effects in case of the not-adapted TG version. In this study, however,
it was not possible to correlate these effects with elevated cellular recombinant
protein levels (Heitzer et al. 2007).
Very recently, a systematic study was published that further verified the value of
codon adjustment for efficient TG expression in C. reinhardtii. This study was set
up to unravel the individual contributions of codon composition and G+C content to
recombinant DNA expression (Barahimipour et al. 2015). Four gene variants of the
YFP reporter protein were synthesized, each varying in relative codon adaptation
and/or the G+C content, cloned into a PSAD expression cassette (Fischer and
Rochaix 2001) and separately transformed into two Chlamydomonas strains, the
expression strain UVM11 and its progenitor, Elow47 (Neupert et al. 2009). Ten
clones, each containing the respective complete expression cassette, were then
randomly selected, and the relative YFP expression levels determined via RNA
gel blot analysis, in-gel protein fluorescence imaging, and confocal laser-scanning
microscopy. The results demonstrated that even with equal G+C content and
varying numbers of vector integration events, a clear correlation of TG expression
and relative codon usage could be observed. The authors concluded that not the G+C
content per se but that optimum codon usage seems to be a key factor for efficient
nuclear TG expression (Barahimipour et al. 2015, 2016).
Gene design for expression studies is common practice today and companies like
Thermo Fisher Scientific Inc. or GenScript USA Inc. offer bioinformatic tools that
generate gene variants optimized for several expression hosts. Since costs for gene
syntheses have continuously been declining over the last decades, rational gene
sequence design and codon adaptation will certainly lead to a rapid increase of the
number of foreign proteins efficiently expressed from the nuclear genome of

C. reinhardtii.
3.6 Selectable Markers and Reporters
A very important aspect for genetic engineering is the development of suitable

transformation markers and reporter genes, and continuing progress has been made
since the first transformation trials were performed. Today, at least 23 nuclear
transformation selection markers (Table 2) and 12 reporters based on color or
light-emission (Table 3) are established for C. reinhardtii.
Since it is possible to generate numerous combinations of the established genetic
elements, increasingly complex projects can be realized, further confirming the
status of C. reinhardtii as a prime candidate for recombinant TG expression in
microalgae.
3.7 Recombinant Protein Production and Targeting
As mentioned above, proteins can be produced from nuclear, chloroplast, and

mitochondrial genomes, and a growing number of recombinant proteins with
potential as high-value products are successfully expressed from the nuclear or
chloroplast genomes [recently reviewed by Rasala and Mayfield (2015)]. In gen-
eral, higher levels of total soluble target protein accumulation can be reached from
chloroplast expression systems, with a typical range of between 1 and 10% of the
total protein. Nuclear-encoded target proteins typically accumulate to lower levels
of below 0.25% of the total protein (Rasala and Mayfield 2015); however, in
contrast to the chloroplast expression systems, options are available to target the
proteins to specific subcellular compartments or for secretion.
Targeting in general is dependent on the presence of specific signals, and
software tools like TargetP (Emanuelsson et al. 2000) and PredAlgo, a software
more suited for green algae (Tardif et al. 2012), have been developed for computer-
based prediction of the subcellular localization of specific proteins in chloroplasts,
mitochondria, or the secretory pathway.
Successful efforts to generate versatile vectors for recombinant protein targeting
from the cytosol to variable subcellular destinations were described in two recent
articles (Rasala et al. 2014; Lauersen et al. 2015) (see Table 4).
Nuclear localization could be reached by C-terminal addition of one copy or a
tandem repeat of the seven amino acid (AA) SV40 large T-antigen nuclear locali-
zation signal. Targeting to chloroplast, mitochondria, or endoplasmic reticulum
(ER) was achieved via addition of various N-terminal peptide sequences. Addition
of the 37 N-terminal AA of the PSAD protein or the 45 AA of the RBCS1 protein led
to import into the chloroplast, whereas addition of a 47 AA peptide derived from the
ATPA gene resulted in targeting to the mitochondrial network (Lauersen et al. 2015;
38 J.H. Mussgnug
Table 2 List of positive transformation markers applied for C. reinhardtii nuclear transformation
experiments
Name Organism, annotation Activity References
aadA Escherichia coli, pR538–1, Resistance to Cerutti et al. (1997),
aminoglycoside spectinomycin and Meslet-Cladiere and
adenyltransferase streptomycin Vallon (2011)
AC29 C. reinhardtii, ALBINO3.1 Complementation of Ferris (1995),
(ALB3.1) yellow, acetate-requiring Bellafiore et al. (2002)
phenotype
ALS C. reinhardtii, acetolactate Resistance to Kovar et al. (2002)
synthase sulfometuron methyl and
related sulfonylurea
herbicides
aph 700 Streptomyces Resistance to Berthold et al. (2002)
hygroscopicus, hygromycin B
aminoglycoside
phosphotransferase
aphVIII Streptomyces rimosus, Resistance to Sizova et al. (1996,
aminoglycoside paromomycin 2001)
phosphotransferase
ARG7 C. reinhardtii, Complementation of Debuchy et al. (1989)
argininosuccinate lyase arginine auxotrophy
ARG9 Arabidopsis thaliana/C. Complementation of Remacle et al. (2009)
reinhardtii, N-acetyl orni- arginine auxotrophy
thine aminotransferase
ATPC C. reinhardtii, ATP Restoration of photosyn- Smart and Selman
synthase subunit thetic competence (1993)
ble Streptoalloteichus Resistance to bleomycin, Stevens et al. (1996),
hindustanus, BLE (BRP) phleomycin and zeo(my) Lumbreras et al. (1998)
protein cin
cat Transposon Tn9, chloram- Resistance to Tang et al. (1995)
phenicol acetyltransferase chloramphenicol
CRY1 C. reinhardtii, ribosomal Resistance to emetine and Nelson et al. (1994)
protein S14 cryptopleurine
gat Synthetic glyphosate Resistance to glyphosate Bruggeman et al.
acetyltransferase (2014), Castle et al.
(2004)
hpt E. coli, hygromycin Resistance to Butanaev (1994),
phosphotransferase hygromycin B Kumar et al. (2004)
NIC7 C. reinhardtii, quinolinate Complementation of Ferris (1995), Ferris
synthetase A nicotinamide auxotrophy et al. (2002)
NIT1 C. reinhardtii, nitrate Restoration of growth on Fernandez et al.
(NIA1) reductase nitrate (1989), Kindle et al.
(1989)
NIT2 C. reinhardtii, nitrogen Restoration of growth on Schnell and Lefebvre
metabolism transcription nitrate (1993), Camargo et al.
factor (2007)
(continued)
Table 2 (continued)
nptII Transposon Tn5, neomycin Resistance to kanamycin, Hall et al. (1993),
phosphotransferase G418, and paromomycin An et al. (1985),
Barahimipour et al.
(2016)
OEE1 C. reinhardtii, oxygen- Restoration of Mayfield and Kindle
evolving enhancer protein 1 photosynthetic (1990)
competence
PDS C. reinhardtii, phytoene Resistance to norflurazon Bruggeman et al.
desaturase (2014)
PPX C. reinhardtii, Resistance to oxyfluorfen Bruggeman et al.
(PPO) protoporphyrinogen (2014), Randolph-
oxidase Anderson et al. (1998)
PSY C. reinhardtii, phytoene Restoration of carotenoid- McCarthy et al. (2004)
synthase less phenotype
TETX Enterobacteriaceae Resistance to tetracycline Garcia-Echauri and
bacterium SL1, tetracycline Cardineau (2015)
resistance protein
THI10 C. reinhardtii, Complementation of thia- Ferris (1995), Ferris
hydroxyethylthiazole mine auxotrophy et al. (2002)
kinase
Alternative names are indicated in brackets. Table modified from (Mussgnug 2015)
Table 3 List of reporters used for color or light-emission detection in C. reinhardtii nuclear
transformation experiments
ARS2 C. reinhardtii, arylsulfatase Color reaction with, Davies et al. (1992), de
e.g., X-Sulf Hostos et al. (1989), Specht
et al. (2014)
xyn1 Trichoderma reesei, Fluorescence from, Rasala et al. (2012)
xylanase 1 e.g., DiFMUX2
substrate
BFP, Entacmaea quadricolor Blue, cyan, green, Fuhrmann et al. (1999),
CFP, (blue), Aequorea victoria orange, red, or Franklin et al. (2002),
GFP, (cyan, green, yellow), yellow fluorescence Rasala et al. (2013),
OPF, Discosoma sp. (orange, red) Neupert et al. (2009),
RFP, fluorescent proteins Lauersen et al. (2015)
YFP
GLUC Gaussia princeps, luciferase Chemiluminescence Fuhrmann et al. (2004),
RLUC Renilla reniformis, luciferase Shao and Bock (2008),
LUCCP Photinus pyralis, luciferase Ruecker et al. (2008),
LUXCT Vibrio harveyi, luciferase Minko et al. (1999),
Matsuo et al. (2006), May
field and Schultz (2004)
DiFMUX2: 6,8-difluoro-4-methylumbelliferyl beta-D-xylobioside; X: 5-Bromo-4-chloro-3-
indolyl. Table modified from (Mussgnug 2015)
40
Table 4 Options for subcellular targeting of recombinant protein as described by Rasala et al. 2014 (1) and Lauersen et al. 2015 (2)
Subcellular target Signal peptide Signal peptide
location origin Signal peptide sequence orientation References
Nucleus SV40 large PKKKRKV C-terminal 1, 2
T-antigen
Chloroplast PSAD MAVMMRTQAPAATRASSRVAVAARPAARRAVVVRAEA N-terminal 1, 2
Chloroplast RBCS1 MAAVIAKSSVSAAVARPARSSVRPMAALKPAVKAAPVAAPAQANQ N-terminal 2
Mitochondria ATPA MRSQALSLARAGLLQLSSQTGASLEGGFALSKRAEQALIRASRAFAS N-terminal 1, 2
ER-secretion ARS1 MHARKMGALAVLAVACLAAVASVAHAADTK N-terminal 1
ER-secretion BIP1 MAQWKAAVLLLALACASYGFGVWAEEEKLGTVIG N-terminal 1
ER-secretion CAH1 MARTGALLLVALALAGCAQAC N-terminal 2
ER retention HDEL C-terminal 1
Peroxisomal PTS1 (Cucurbita IHHPRELSRL C-terminal 2
microbodies sp.)
Peroxisomal PTS1 HIVTKTPSRM C-terminal 2
microbodies (C. reinhardtii)
Peroxisomal PTS1-like peptide SWRRSLI C-terminal 2
microbodies
ER endoplasmic reticulum
J.H. Mussgnug
Rasala et al. 2014). ER targeting was observed with three signal peptides, derived
from the arylsulfatase ARS1 (30 AA), the BIP1 chaperon protein (34 AA), or the
C. reinhardtii carbonic anhydrase CAH1 (21 AA), respectively. C-terminal addition
of an ER retention signal (HDEL) was demonstrated to prevent secretion and retain
the recombinant protein in the ER.
Five of the six enzymes associated with the glyoxylate cycle were recently
shown to reside in peroxisomal microbodies (Lauersen et al. 2016), one of which
being the malate synthase PTS1. C-terminal addition of the respective 10 AA signal
peptides derived from the pumpkin or Chlamydomonas malate synthase, as well as
a 7 AA PTS1-like peptide, resulted in successful targeting into these microstruc-
tures (Table 4).
It should be noted that the establishment of expression vectors facilitating
controlled subcellular protein targeting is an important step in terms of nuclear
tool development, because this will allow implementation of increasingly complex
metabolic pathway engineering projects in C. reinhardtii.
4 Gene Expression Inhibition
The generation of mutants deficient in specific nuclear gene expression has been
invaluable to study gene functions. In principle, random or targeted mutagenesis
strategies can be applied, and variable mutagens and vector tools have been
established for this purpose.
4.1 Random Mutation Strategies
Mutagenesis of the nuclear genome of C. reinhardtii can be induced via application

of ionizing radiation, mutagenic chemicals, or by DNA insertion. Irrespective of the
mutagen, the nuclear genome modifications occur at apparently random loci,
however, notable mutagen-dependent characteristics of the resulting cell lines
should be taken into account.
4.1.1 Mutagenesis Via Radiation or Chemicals
Treatment of Chlamydomonas with X-rays or UV irradiation dates back to the

1950s (Ebersold 1956; Nybom 1953), and the mutagenic effect is based on phys-
ically induced DNA damage, e.g., DNA breakage or lesions resulting from the
formation of pyrimidine dimers. Incomplete repair of the DNA damage can then
result in the appearance of aberrant, heritable mutant phenotypes.
Many chemicals have the potential to react with DNA and induce mutagenesis, and
prominent agents applied for C. reinhardtii include methylnitronitrosoguanidine
42 J.H. Mussgnug
(MNNG), methyl methanesulfonate (MMS), and ethylmethanesulfonate (EMS) (Harris

2009). These substances induce mutagenesis by DNA alkylation [here: addition of
methyl or ethyl groups (Rhaese and Boetker 1973)], resulting in the occurrence of
mismatched base pairs and potentially other forms of DNA damage.
Although the underlying mechanism that cause the DNA modifications differ,
the resulting cell lines after physical or chemical mutagenesis show several com-
mon characteristics. A notable feature of mutagenesis by radiation or chemicals is
that the resulting strains are not considered to be genetically modified organisms
(GMO). This is important because strict regulations apply for GMOs in many
countries, making outdoor or commercial applications difficult and cost-intensive.
In addition, in contrast to insertional mutagenesis, both mutagenic strategies com-
monly result in locally confined DNA alterations and therefore can create gain-of-
function or loss-of-function gene mutations (Dent et al. 2001). Other mutual
features are that the individual DNA mutation event per se does not allow positive
selection and that the subsequent determination of the mutation event number and
the respective affected DNA region, if desired, pose substantial difficulties.
Although several methods like, e.g., classical genetic mapping, TILLING [targeting
induced local lesions in genomes (McCallum et al. 2000)], or even full-genome
sequencing can be applied for this purpose, the implementation is technically
challenging and labor-intensive (Dutcher et al. 2012; Schierenbeck et al. 2015;
Harris 2009).
4.1.2 Insertional Mutagenesis
As mentioned in Sect. 2, foreign DNA molecules integrate at apparently random

nuclear loci, irrespective of the method applied for DNA transformation. Insertional
mutagenesis offers notable advantages compared to mutagenesis by chemicals or
irradiation. Most importantly, identification of the nuclear insertion sites is rather
easy because knowledge of the introduced DNA sequence allows application of
several PCR-based methods aiming for amplification of the flanking nuclear region
(Galvan et al. 2007; Strauss et al. 2001; Zhang et al. 2014), therefore facilitating
functional genomic approaches (Dent et al. 2005, 2015; Li et al. 2016).
The insertion events are of rather uncontrolled nature, as vividly evidenced by
the fact that large nuclear deletions in the range of 50 kb can occur, fragments of the
transgene construct can be lost or rearranged during the procedure, and multiple
plasmid insertions are observed on a regular basis (Harris 2009; Gumpel and Purton
1994). Recent high-throughput genotyping studies showed that uncontrolled DNA
digestion and ligation events can take place, which are probably caused by enzymes
from lysed cells (Zhang et al. 2014; Li et al. 2016). Although it is quite easy to
determine the number of plasmid DNA insertions via DNA gel blot analyses after
transformation, confirmation of cosegregation of marker and phenotype by crossing
experiments is an important step for functional genomics approaches. Dent et al.
(2005) isolated random plasmid insertion mutants with photosynthesis-related
phenotypes after biolistic particle bombardment and sequenced the flanking DNA
Table 5 Notable features of nuclear random mutation strategies

Mutagenesis via irradiation or chemicals Mutagenesis via DNA insertion
Considered non-GMO Considered GMO
Can be applied to create loss-of-function and Not well suited to create gain-of-function
gain-of-function mutations mutations
Mutation event does not per se create a pos- Usage of appropriate markers allows direct
itive selection marker selection for positive transformants
Determination of the number of mutation Determination of the number of DNA insertions
events can be difficult is comparably easy, but untagged mutants reg-
ularly occur
Localization of the altered DNA region Identification of the nuclear regions flanking the
responsible for a mutant phenotype is difficult DNA insertion site is comparably easy
regions via TAIL-PCR. Sequence data could be determined for 50 mutants; how-
ever, backcrossing of 17 of these mutants revealed that only 50% showed
molecular marker and phenotype cosegregation (Dent et al. 2005), thus demon-
strating that half of the cell lines represented untagged mutants. A related but
larger-scale study was published recently. Here, glass bead transformation was
performed to generate a collection of 49,000 mutants. After prescreening for
photosynthesis-related phenotypes, 459 flanking DNA sequences derived from
439 mutants could be isolated. Interestingly, cosegregation of 17 out of 20 mutants
was reported in this study, corresponding to 85% (Dent et al. 2015).
It is not possible to draw a general conclusion regarding a typical ratio of
cosegregation at this point, because the overall number of cell lines analyzed still
is comparably low, and it is very likely that the ratio can depend on several
experimental parameters. The fact, however, that untagged mutants are found
quite often is a clear indication that an unknown number of background mutation
events can take place during DNA insertional mutagenesis, potentially triggered by
the transformation procedure or by spontaneous events. Since the overall mutation
event number can therefore apparently be significantly higher than the number of
DNA plasmid insertions determined by concomitant DNA gel blot analyses,
assignment of specific gene functions will generally require further experiments,
e.g., functional complementation.
Since small or large deletions often occur at the insertion site (Dent et al. 2015),
insertional mutagenesis is not well suited to generate gain-of-function mutants, and
the presence of foreign DNA classifies the mutants as GMO.
Some key considerations discussed in this paragraph are summarized in Table 5.
4.2 Targeted Mutation Strategies
Two general options are currently available if reduction of the expression of a

specific nuclear Chlamydomonas gene is desired: (a) RNA-dependent gene silenc-
ing or (b) direct gene disruption via DNA insertion, homologous recombination, or
44 J.H. Mussgnug
directed endonuclease activity. Since two recently published review articles

describe this topic in greater detail (Jinkerson and Jonikas 2015; Mussgnug
2015), a compact summary will be provided here.
4.2.1 RNA-Dependent Gene Silencing
Gene-silencing strategies based on expression of antisense RNA (Schroda et al.

1999), inverted repeats (Fuhrmann et al. 2001), and micro-RNAs (miRNAs)
(Hu et al. 2014; Molnar et al. 2009; Zhao et al. 2009) have all been successfully
applied in C. reinhardtii, and even a few customizable vectors for this purpose were
developed (see Sect. 5 for two examples). Furthermore, conditional gene silencing
has been achieved by incorporation of inducible silencing construct (Schmollinger
et al. 2010; Koblenz and Lechtreck 2005). This can be advantageous compared to
knockout strategies, because the silencing effect can be temporarily induced, and
the subsequent alleviation of gene repression can prevent long-term cellular adap-
tation reactions. A notable characteristic of gene-silencing strategies is that the
silencing is often incomplete (Schroda 2006). This might in some cases be an
advantage, e.g., in case essential genes are investigated; however, residual gene
expression can substantially complicate unambiguous phenotype assignments. The
stability of gene silencing can also be an issue, and loss of the silencing phenotype
has often been observed (Schroda 2006). Therefore, for several research tasks,
generation of stable knockout cell lines by direct gene disruption is a desired
alternative.
4.2.2 Direct Gene Disruption
Homologous recombination is a principle option to delete specific genes, and Zorin

et al. (2005) applied a method based on the use of single-stranded DNA to the
nuclear genome of C. reinhardtii. The authors succeeded in increasing the ratio of
site-specific vs. random integration events and successfully isolated two mutants of
the PHOT gene. Identification of specific deletion mutants with this method,
however, appears to be quite challenging since only very few successful examples
were reported since then (Zorin et al. 2005, 2009).
Site-specific endonucleases have been used to create mutants of many pro- and
eukaryotes, and the three main strategies have been approached for Chlamydomonas:
zinc-finger nucleases (ZFNs), transcription activator-like effector nucleases (TALENs),
and clustered regularly interspaced short palindromic repeats (CRISPR)/CRISPR-
associated (Cas) system. A ZFN approach was successfully performed by Sizova
et al. (2013), who used this method to knockout the COP3 gene (Sizova et al. 2013).
TALE proteins were applied successfully to activate endogenous gene expression (Gao
et al. 2014, 2015); however, FokI nuclease domain coupling for targeted gene knockout
was not yet demonstrated.
The first trials to introduce the CRISPR/Cas9 system for C. reinhardtii were
published by Jiang et al. (2014), and it was shown that the system is functional, but
lack of surviving transformants indicated possible toxicity issues (Jiang et al. 2014).
Work of Greiner (Humboldt University Berlin), however, provided evidence that
expression of a Cas9-YFP fusion protein in C. reinhardtii was possible, and specific
Cas9 nuclease activity was detectable (Greiner 2014). Very recently, Shin et al.
(2016) demonstrated the successful generation of knockout and knock-in mutants
via direct intracellular delivery of commercially manufactured, specific sgRNA/
Cas9 ribonucleoproteins (RNPs) by electroporation (Shin et al. 2016). As a proof of
concept, the authors independently targeted the loci of MAA7, CpSRP43, and
ChlM, with the idea that knockout of these targets would lead to easily detectable
phenotypes. Indeed, mutants of all three target loci could be isolated; however,
currently unknown events led to curious in-frame indel patterns, or when
co-transformation was performed to enhance RNP delivery, unexpected DNA
vector insertions at the Cas9 cut sites (Shin et al. 2016). In a similar approach,
Baek and colleagues used CRISPR-Cas ribonucleoproteins to generate a two-gene
knockout cell line that constitutively produced the pigment zeaxanthin (Baek et al.
2016). Despite this proof of principle, a versatile CRISPR-Cas-based DNA tool is
not yet available for Chlamydomonas. The range of microalgal species accessible
via CRISPR-Cas-based methods, however, is rapidly expanding and already
includes the oleaginous species Nannochloropsis oceanica (Wang et al. 2016)
and the marine diatom Phaeodactylum tricornutum (Nymark et al. 2016).
An alternative strategy to obtain knockout cell lines for a specific gene is the
generation of large-scale random DNA insertion mutant collections and subsequent
identification of the cell line affected in expression of the gene of interest. This
strategy has been applied with notable success. Gonzales-Ballester and colleagues
(2011) created two large-scale mutant collections with a total of 122,000 cell lines
by insertional mutagenesis of the AphVIII marker gene, conferring resistance to the
antibiotic paromomycin. Systematic DNA superpools from these mutants were
generated, which allowed subsequent PCR-based screenings and identification of
individual cell lines with specifically affected target regions (Gonzalez-Ballester
et al. 2011).
Zhang et al. (2014) introduced a promising new method designated
ChlaMmeSeq (Chlamydomonas MmeI-based insertion site sequencing) and showed
that this method can be applied to simultaneously map thousands of insertion sites
in pooled mutant cell lines. The technique is based on the extraordinary character-
istics of the MmeI restriction enzyme, which can be exploited for the high-
throughput identification of 20–21 bp flanking genomic DNA sequence tags
(Zhang et al. 2014). The procedure recently was applied as part of an advanced
mapping approach in a CC-4533 cell line background. Despite notable difficulties
based on cassette truncations and interfering DNA rearrangements resulting in no or
misleading flanking site identifications, an initial indexed library of 1935 mutants
(representing 1562 genes) could successfully be established (Li et al. 2016). Since
then, the total number of mutants of this library has been increased to 37,000
46 J.H. Mussgnug
(as of April 2016), and access is possible via the website https://www.
chlamylibrary.org/.
It should be noted that generation and maintenance of large-scale
Chlamydomonas mutant collections is still very labor-intensive, and in case the
generation of a knockout cell line within a specific cellular background is aimed for,
de novo setup of such a strategy is not a practical option for many laboratories.
As a conclusion, a major current limitation of Chlamydomonas genetic engi-
neering remains the absence of an efficient and easily adaptable tool to generate a
specific nuclear knockout mutation in a distinct Chlamydomonas cell line.
5 Customizable Vectors and Expression Strain
5.1 Selected Vectors for Diverse Practical Applications
The construction or modification of DNA plasmid vectors is a routine procedure in

genetic engineering projects. The number of vectors comprising one or more of the
elements listed in Tables 1, 2, and 3 has been growing very fast, and it is beyond the
scope of this article to present a comprehensive overview of these plasmids. It
should be noted that most of the vectors were applied for a specific purpose within a
research project, and only a limited number has been designed for versatile,
customizable applications. The following selected examples, all being available
at the Chlamydomonas Resource Center, represent versatile vectors that are appli-
cable for diverse nuclear genetic engineering tasks, ranging from tagged recombi-
nant protein expression to inducible gene silencing.
5.1.1 pGenD
The pGenD vector was introduced by Fischer and Rochaix (2001) as a versatile
nuclear gene expression vector. The expression cassette is based on the intron-free
PsaD gene and comprises 822 bp of the PsaD 50 upstream region, 591 bp coding
region, and 624 bp of the 30 downstream region (Fischer and Rochaix 2001).
Versatility of the vector was reached by introducing the unique NdeI and EcoRI
restriction sites into the expression cassette, allowing fast and easy replacement of
the coding sequence. The same regulatory elements were used for the derived
pJR38/39 expression vectors (Neupert et al. 2009).
5.1.2 Maa7/X IR (NE-537)
This construct was created by Rohr et al. (2004) and can be used for target gene
silencing via RNA interference (RNAi). The expression cassette is controlled by the
RBCS2 promoter and the 35S terminator and comprises an inverted repeat derived
from the endogenous MAA7 30 UTR. The inverted repeat region is separated by a
DNA spacer which can easily be replaced by a target sequence via DNA restriction
(EcoRI) and insert ligation. The target insert must comprise an inverted repeat
sequence derived from the target gene and should be separated by a DNA spacer.
The final silencing cassette therefore is constructed to allow the formation of a
double-stranded RNA hairpin-loop structure that triggers co-silencing of the endog-
enous MAA7 and the specific target gene. MAA7 encodes the Chlamydomonas
tryptophan synthase ß subunit, and silencing of this gene confers resistance to
5-fluoroindole, since the enzymatic conversion into the toxic 5-fluorotryptophan
is prevented (Rohr et al. 2004). This allows direct selection for cell lines which
show efficiently co-silenced marker and target genes, even facilitating the identifi-
cation of cell lines with efficiently silenced gene families (Mussgnug et al. 2007).
5.1.3 pProm-Chlamy (pHsp70A/RbcS2-Chlamy)
Although it is possible to introduce a nonselectable gene present on one vector by

co-transformation with a selectable marker present on a second vector, efficiency
strongly increases if both cassettes are present on the same plasmid. Heitzer and
Zschoernig (2007) introduced a strategy for construction of Chlamydomonas tan-
dem expression vectors utilizing in vitro plasmid fusion via Cre/loxP recombination.
The pProm-Chlamy vectors furthermore were designed to contain unique restriction
sites to allow modular replacement of promoter, coding region, and 30 UTR (Heitzer
and Zschoernig 2007).
5.1.4 pChlamiRNA1–3
Molnar et al. (2009) developed a versatile plasmid vector system for miRNA-
mediated gene silencing. The pChlamiRNA vectors are based expression of the
miRNA cre-MIR1157, and the most versatile versions allow easy targeting of
specific genes of interest. The authors provide detailed instructions for vector
customization as supporting information, including target site identification
(Ossowski et al. 2008), amiRNA design and respective DNA oligonucleotide
preparation, and vector assembly (Molnar et al. 2009). This tool was further
modified by Schmollinger et al. (2010) to include the inducible NIT1 promoter,
thus allowing conditional amiRNA expression, a strategy successfully applied
before for an inverted repeat RNAi gene-silencing construct (Schmollinger et al.
2010; Koblenz and Lechtreck 2005).
48 J.H. Mussgnug
5.1.5 pOptimized (pOpt)
The pOpt plasmid toolkit for recombinant protein synthesis was designed in silico and
constructed in a strictly modular fashion (Lauersen et al. 2015). The vector system is
based on two tandem expression cassettes, one destined for the selection marker and the
other for the recombinant protein, which can furthermore be customized by tagging and
modified for subcellular targeting. The inclusion of unique restriction sites for each of
the modules prior to de novo DNA synthesis of the vector and the exchangeable
elements allows highly flexible and simple adaptation of both expression cassettes.
The initial version of the pOpt toolkit comprised two selectable transformation
markers, five reporter tagging, and six subcellular localization options. Because of
the modular design, it can easily be expanded by additional modules.
5.2 Cell Lines Promoting Nuclear Transgene Expression
Recombinant TG expression from the nuclear C. reinhardtii genome has proven to be

difficult in many cases. One approach to overcome this problem is the development of
cell lines with improved expression characteristics, and Neupert et al. (2009) success-
fully devised a sophisticated genetic screen for this purpose. Briefly, co-transformation
of an arginine auxotroph cell line (cw15-302) was performed with two plasmids, one
restoring arginine prototrophy and the other conferring resistance to the antibiotic
emetine. A cell line was then selected which could tolerate low emetine concentrations
(5–25 μg ml1) but died when exposed to elevated antibiotic levels. This cell line,
designated Elow47, was then exposed to UV radiation and the resulting mutants
screened on high emetine concentrations (60 μg ml1), with the idea to select cell
lines where initial transcriptional repression was alleviated. Indeed, two cell lines,
designated UVM4 and UVM11, could be isolated that efficiently expressed foreign
transgenes (Neupert et al. 2009; Barahimipour et al. 2015, 2016; Lauersen et al. 2013).
In addition to the UVM strains, improved TG expression was recently also shown for
an insertional mutant of the putative maintenance-type DNA cytosine
methyltransferase MET1 (Kong et al. 2015), which therefore represents an interesting
alternative.
6 Concluding Remarks and Future Perspectives
As outlined in this article, nuclear mutagenesis of C. reinhardtii is a routine procedure

today, and screening of mutant collections comprising many thousands of cell lines has
been successfully performed (Terashima et al. 2015; Gonzalez-Ballester et al. 2011;
Zhang et al. 2014; Dent et al. 2015; Li et al. 2016). It can be expected that ongoing and
future large-scale approaches will lead to the isolation of further defined mutants
invaluable for the elucidation of currently unknown cellular processes and regulatory
networks. Conservation of such large cell line collections, however, is still technically
challenging, despite recent progress in developing high-throughput procedures for cell
line propagation and cryopreservation (Li et al. 2016). Furthermore, as long as a
knockout mutant is not available for a desired cell line, the lack of an efficient tool
applicable for generation of targeted nuclear knockout strains or site-specific genome
editing still represents a major drawback.
The utilization of the bacterial CRISPR/Cas system has been a major technological
breakthrough in the field of genetic engineering for many pro- and eukaryotes.
Unfortunately, adaptation of the original method comprising the Cas9 enzyme from
Streptococcus pyogenes (SpCas9) (Jinek et al. 2012) to Chlamydomonas seems to be
rather difficult. Due to the impressively fast progress in this research field, including the
generation of rationally engineered SpCas9 variants (Slaymaker et al. 2016; Kleinstiver
et al. 2016) and identification of alternative nucleases like the Cas9 homologue from
Staphylococcus aureus (SaCas9) (Ran et al. 2015) or the programmable Cpf1 endonu-
cleases from Acidaminococcus sp. BV3L6 and Lachnospiraceae bacterium ND2006
(Zetsche et al. 2015), it seems likely that establishment of such a versatile editing tool
for Chlamydomonas—a major goal for decades—will eventually be achieved in the
near future.
Metabolic pathway engineering of C. reinhardtii, especially when several engineer-
ing steps or multiple cellular compartments are involved, is still very much in its
infancy. The emerging efforts to create modular and more versatile genetic tools,
combined with novel options for TG expression modification, e.g., via riboswitches,
enhancer elements, or 2A peptide sequences, have opened the doors to tackle increas-
ingly sophisticated engineering tasks. In this context, the further development and
community-wide implementation of standardized procedures, from cell cultivation to
cloning methods like, e.g., Golden Gate assembly (Engler et al. 2008, 2014), would be
advisable.
Given that C. reinhardtii combines several features common to plants, bacteria,
and yeast, the establishment of C. reinhardtii as an industrial biotechnology
platform by implementing synthetic biology and modular DNA device strategies
(Scaife et al. 2015) represents a logical next step to advance fundamental and
applied microalgal research.
Acknowledgments I thank Dr. Lutz Wobbe for critical comments on the manuscript and the
German state North Rhine-Westphalia for funding.
Conflict of Interest I declare no conflict of interest.
References
An G, Watson BD, Stachel S, Gordon MP, Nester EW (1985) New cloning vehicles for transformation
of higher plants. EMBO J 4(2):277–284
Baba M, Hanawa Y, Suzuki I, Shiraiwa Y (2011) Regulation of the expression of H43/Fea1 by
multi-signals. Photosynth Res 109(1–3):169–177
50 J.H. Mussgnug
Baek K, Kim DH, Jeong J, Sim SJ, Melis A, Kim JS, Jin E, Bae S (2016) DNA-free two-gene
knockout in Chlamydomonas reinhardtii via CRISPR-Cas9 ribonucleoproteins. Sci Rep
6:30620
Barahimipour R, Strenkert D, Neupert J, Schroda M, Merchant SS, Bock R (2015) Dissecting the
contributions of GC content and codon usage to gene expression in the model alga
Chlamydomonas reinhardtii. Plant J. doi:10.1111/tpj.13033
Barahimipour R, Neupert J, Bock R (2016) Efficient expression of nuclear transgenes in the green
alga Chlamydomonas: synthesis of an HIV antigen and development of a new selectable
marker. Plant Mol Biol. doi:10.1007/s11103-015-0425-8
Bell SA, Shen C, Brown A, Hunt AG (2016) Experimental genome-wide determination of RNA
polyadenylation in Chlamydomonas reinhardtii. PLoS One 11(1):e0146107. doi:10.1371/jour
nal.pone.0146107
Bellafiore S, Ferris P, Naver H, Gohre V, Rochiax JD (2002) Loss of Albino3 leads to the specific
depletion of the light-harvesting system. Plant Cell 14(9):2303–2314
Berger H, Blifernez-Klassen O, Ballottari M, Bassi R, Wobbe L, Kruse O (2014) Integration of
carbon assimilation modes with photosynthetic light capture in the green alga Chlamydomonas
reinhardtii. Mol Plant 7(10):1545–1559
Berthold P, Schmitt R, Mages W (2002) An engineered Streptomyces hygroscopicus aph 700 gene
mediates dominant resistance against hygromycin B in Chlamydomonas reinhardtii. Protist
153(4):401–412
Blankenship JE, Kindle KL (1992) Expression of chimeric genes by the light-regulated cabII-1
promoter in Chlamydomonas reinhardtii: a cabII-1/nit1 gene functions as a dominant selectable
marker in a nit1- nit2-strain. Mol Cell Biol 12(11):5268–5279
Blowers AD, Bogorad L, Shark KB, Sanford JC (1989) Studies on Chlamydomonas chloroplast
transformation: foreign DNA can be stably maintained in the chromosome. Plant Cell 1
(1):123–132
Boynton JE, Gillham NW, Harris EH, Hosler JP, Johnson AM, Jones AR, Randolph-Anderson BL,
Robertson D, Klein TM, Shark KB, Sanford JC (1988) Chloroplast transformation in
Chlamydomonas with high velocity microprojectiles. Science 240(4858):1534–1538
Brown LE, Sprecher SL, Keller LR (1991) Introduction of exogenous DNA into Chlamydomonas
reinhardtii by electroporation. Mol Cell Biol 11(4):2328–2332
Bruggeman AJ, Kuehler D, Weeks DP (2014) Evaluation of three herbicide resistance genes for
use in genetic transformations and for potential crop protection in algae production. Plant
Biotechnol J 12(7):894–902
Brunke KJ, Anthony JG, Sternberg EJ, Weeks DP (1984) Repeated consensus sequence and
pseudopromoters in the four coordinately regulated tubulin genes of Chlamydomonas
reinhardi. Mol Cell Biol 4(6):1115–1124
Butanaev AM (1994) Use of the hygromycin phosphotransferase gene as the dominant selective
marker for Chlamydomonas reinhardtii transformation. Mol Biol 28(5):1061–1068
Camargo A, Llamas A, Schnell RA, Higuera JJ, Gonzalez-Ballester D, Lefebvre PA, Fernandez E,
Galvan A (2007) Nitrate signaling by the regulatory gene NIT2 in Chlamydomonas. Plant Cell
19(11):3491–3503
Castle LA, Siehl DL, Gorton R, Patten PA, Chen YH, Bertain S, Cho HJ, Duck N, Wong J, Liu DL,
Lassner MW (2004) Discovery and directed evolution of a glyphosate tolerance gene. Science
304(5674):1151–1154
Cerutti H, Johnson AM, Gillham NW, Boynton JE (1997) A eubacterial gene conferring specti-
nomycin resistance on Chlamydomonas reinhardtii: integration into the nuclear genome and
gene expression. Genetics 145(1):97–110
Croft MT, Lawrence AD, Raux-Deery E, Warren MJ, Smith AG (2005) Algae acquire vitamin
B12 through a symbiotic relationship with bacteria. Nature 438(7064):90–93
Croft MT, Moulin M, Webb ME, Smith AG (2007) Thiamine biosynthesis in algae is regulated by
riboswitches. Proc Natl Acad Sci USA 104(52):20770–20775
Davies JP, Weeks DP, Grossman AR (1992) Expression of the arylsulfatase gene from the beta-2-
tubulin promoter in Chlamydomonas reinhardtii. Nucleic Acids Res 20(12):2959–2965
Davis IW, Benninger C, Benfey PN, Elich T (2012) POWRS: position-sensitive motif discovery.
PLoS One 7(7):e40373
Day A, Debuchy R, Vandillewijn J, Purton S, Rochaix JD (1990) Studies on the maintenance and
expression of cloned DNA fragments in the nuclear genome of the green alga Chlamydomonas
reinhardtii. Physiol Plant 78(2):254–260
de Hostos EL, Schilling J, Grossman AR (1989) Structure and expression of the gene encoding the
periplasmic arylsulfatase of Chlamydomonas reinhardtii. Mol Gen Genet 218(2):229–239
Debuchy R, Purton S, Rochaix JD (1989) The argininosuccinate lyase gene of Chlamydomonas
reinhardtii: an important tool for nuclear transformation and for correlating the genetic and
molecular maps of the ARG7 locus. EMBO J 8(10):2803–2809
Deng XD, Yang JH, Wu XX, Li YJ, Fei XW (2014) A C2H2 zinc finger protein FEMU2 is
required for fox1 expression in Chlamydomonas reinhardtii. PLoS One 9(12). doi:10.1371/
journal.pone.0112977
Dent RM, Han M, Niyogi KK (2001) Functional genomics of plant photosynthesis in the fast lane
using Chlamydomonas reinhardtii. Trends Plant Sci 6(8):364–371
Dent RM, Haglund CM, Chin BL, Kobayashi MC, Niyogi KK (2005) Functional genomics of
eukaryotic photosynthesis using insertional mutagenesis of Chlamydomonas reinhardtii. Plant
Physiol 137(2):545–556
Dent RM, Sharifi MN, Malnoe A, Haglund C, Calderon RH, Wakao S, Niyogi KK (2015) Large-scale
insertional mutagenesis of Chlamydomonas supports phylogenomic functional prediction of pho-
tosynthetic genes and analysis of classical acetate-requiring mutants. Plant J. doi:10.1111/tpj.12806
Diaz-Santos E, de la Vega M, Vila M, Vigara J, Leon R (2013) Efficiency of different heterologous
promoters in the unicellular microalga Chlamydomonas reinhardtii. Biotechnol Prog 29
(2):319–328
Ding J, Li XM, Hu HY (2012) Systematic prediction of cis-regulatory elements in the Chlamydomonas
reinhardtii genome using comparative genomics. Plant Physiol 160(2):613–623
Dunahay TG (1993) Transformation of Chlamydomonas reinhardtii with silicon-carbide whiskers.
BioTechniques 15(3):452–460
Dutcher SK, Li L, Lin H, Meyer L, Giddings TH Jr, Kwan AL, Lewis BL (2012) Whole-genome
sequencing to identify mutants and polymorphisms in Chlamydomonas reinhardtii. G3 Genes
Genomes Genetics 2(1):15–22
Ebersold WT (1956) Crossing over in Chlamydomonas reinhardi. Am J Bot 43(6):408–410
Eichler-Stahlberg A, Weisheit W, Ruecker O, Heitzer M (2009) Strategies to facilitate transgene
expression in Chlamydomonas reinhardtii. Planta 229(4):873–883
Emanuelsson O, Nielsen H, Brunak S, von Heijne G (2000) Predicting subcellular localization of
proteins based on their N-terminal amino acid sequence. J Mol Biol 300(4):1005–1016
Engler C, Kandzia R, Marillonnet S (2008) A one pot, one step, precision cloning method with
high throughput capability. PLoS One 3(11):e3647
Engler C, Youles M, Gruetzner R, Ehnert TM, Werner S, Jones JD, Patron NJ, Marillonnet S
(2014) A golden gate modular cloning toolbox for plants. ACS Synth Biol 3(11):839–843
Fei XW, Deng XD (2007) A novel Fe deficiency-responsive element (FeRE) regulates the
expression of atx1 in Chlamydomonas reinhardtii. Plant Cell Physiol 48(10):1496–1503
Fei XW, Eriksson M, Yang JH, Deng XD (2009) An Fe deficiency responsive element with a core
sequence of TGGCA regulates the expression of FEA1 in Chlamydomonas reinhardtii. J Biochem
146(2):157–166
Fei XW, Eriksson M, Li YJ, Deng XD (2010) A novel negative Fe-deficiency-responsive element
and a TGGCA-type-like FeRE control the expression of FTR1 in Chlamydomonas reinhardtii.
J Biomed Biotechnol. doi:10.1155/2010/790247
Fernandez E, Schnell R, Ranum LPW, Hussey SC, Silflow CD, Lefebvre PA (1989) Isolation and
characterization of the nitrate reductase structural gene of Chlamydomonas reinhardtii. Proc
Natl Acad Sci USA 86(17):6449–6453
52 J.H. Mussgnug
Ferrante P, Diener DR, Rosenbaum JL, Giuliano G (2011) Nickel and low CO2-controlled motility
in Chlamydomonas through complementation of a paralyzed flagella mutant with chemically
regulated promoters. BMC Plant Biol 11. doi:10.1186/1471-2229-11-22
Ferris PJ (1995) Localization of the nic-7, ac-29 and thi-10 genes within the mating-type locus of
Chlamydomonas reinhardtii. Genetics 141(2):543–549
Ferris PJ, Armbrust EV, Goodenough UW (2002) Genetic structure of the mating-type locus of
Chlamydomonas reinhardtii. Genetics 160(1):181–200
Fischer N, Rochaix JD (2001) The flanking regions of PsaD drive efficient gene expression in the
nucleus of the green alga Chlamydomonas reinhardtii. Mol Gen Genomics 265(5):888–894
Franklin S, Ngo B, Efuet E, Mayfield SP (2002) Development of a GFP reporter gene for
Chlamydomonas reinhardtii chloroplast. Plant J 30(6):733–744
Fuhrmann M, Oertel W, Hegemann P (1999) A synthetic gene coding for the green fluorescent
protein (GFP) is a versatile reporter in Chlamydomonas reinhardtii. Plant J 19(3):353–361
Fuhrmann M, Stahlberg A, Govorunova E, Rank S, Hegemann P (2001) The abundant retinal
protein of the Chlamydomonas eye is not the photoreceptor for phototaxis and photophobic
responses. J Cell Sci 114(21):3857–3863
Fuhrmann M, Hausherr A, Ferbitz L, Schodl T, Heitzer M, Hegemann P (2004) Monitoring
dynamic expression of nuclear genes in Chlamydomonas reinhardtii by using a synthetic
luciferase reporter gene. Plant Mol Biol 55(6):869–881
Galvan A, Gonzalez-Ballester D, Fernandez E (2007) Insertional mutagenesis as a tool to study
genes/functions in Chlamydomonas. In: Leon R, Galvan A, Fernandez E (eds) Transgenic
microalgae as green cell factories, vol 616. Landes Bioscience, pp 77–89
Gao H, Wright DA, Li T, Wang YJ, Horken K, Weeks DP, Yang B, Spalding MH (2014) TALE
activation of endogenous genes in Chlamydomonas reinhardtii. Algal Res 5:52–60
Gao H, Wang Y, Fei X, Wright DA, Spalding MH (2015) Expression activation and functional
analysis of HLA3, a putative inorganic carbon transporter in Chlamydomonas reinhardtii. Plant
J. doi:10.1111/tpj.12788
Garcia-Echauri SA, Cardineau GA (2015) TETX: a novel nuclear selection marker for
Chlamydomonas reinhardtii transformation. Plant Methods 11:27
Goldschmidt-Clermont M, Rahire M (1986) Sequence, evolution and differential expression of the
two genes encoding variant small subunits of ribulose bisphosphate carboxylase/oxygenase in
Chlamydomonas reinhardtii. J Mol Biol 191(3):421–432
Gonzalez-Ballester D, Pootakham W, Mus F, Yang W, Catalanotti C, Magneschi L, de
Montaigu A, Higuera JJ, Prior M, Galvan A, Fernandez E, Grossman AR (2011) Reverse
genetics in Chlamydomonas: a platform for isolating insertional mutants. Plant Methods 7:24
Greiner A (2014) CRISPR/Cas9 und Zinkfinger-Nukleasen für die gezielte Genstilllegung in
Chlamydomonas reinhardtii. Dissertation, Humboldt University Berlin, Berlin
Grewe S, Ballottari M, Alcocer M, D’Andrea C, Blifernez-Klassen O, Hankamer B, Mussgnug JH,
Bassi R, Kruse O (2014) Light-harvesting complex protein LHCBM9 is critical for photosystem II
activity and hydrogen production in Chlamydomonas reinhardtii. Plant Cell 26(4):1598–1611
Guilley H, Dudley RK, Jonard G, Balazs E, Richards KE (1982) Transcription of Cauliflower
mosaic virus DNA: detection of promoter sequences, and characterization of transcripts. Cell
30(3):763–773
Gumpel NJ, Purton S (1994) Playing tag with Chlamydomonas. Trends Cell Biol 4(8):299–301
Gumpel NJ, Rochaix JD, Purton S (1994) Studies on homologous recombination in the green alga
Chlamydomonas reinhardtii. Curr Genet 26(5–6):438–442
Hahn D, Kück U (1999) Identification of DNA sequences controlling light- and chloroplast-dependent
expression of the lhcb1 gene from Chlamydomonas reinhardtii. Curr Genet 34(6):459–466
Hall LM, Taylor KB, Jones DD (1993) Expression of a foreign gene in Chlamydomonas reinhardtii.
Gene 124(1):75–81
Hallmann A, Wodniok S (2006) Swapped green algal promoters: aphVIII-based gene constructs
with Chlamydomonas flanking sequences work as dominant selectable markers in Volvox and
vice versa. Plant Cell Rep 25(6):582–591
Harris EH (2009) The Chlamydomonas sourcebook: introduction to Chlamydomonas and its

laboratory use, 2nd edn. Academic Press, Oxford
Hasnain SE, Manavathu EK, Leung WC (1985) DNA-mediated transformation of
Chlamydomonas reinhardtii cells: use of aminoglycoside 30 -phosphotransferase as a selectable
marker. Mol Cell Biol 5(12):3647–3650
Hayashi M, Hirono M, Kamiya R (2001) Recovery of flagellar dynein function in a Chlamydomonas
actin/dynein-deficient mutant upon introduction of muscle actin by electroporation. Cell Motil
Cytoskeleton 49(3):146–153
Heitzer M, Zschoernig B (2007) Construction of modular tandem expression vectors for the green
alga Chlamydomonas reinhardtii using the Cre/lox-system. BioTechniques 43(3):324–332
Heitzer M, Eckert A, Fuhrmann M, Griesbeck C (2007) Influence of codon bias on the expression
of foreign genes in microalgae. In: Leon R, Galvan A, Fernandez E (eds) Transgenic
microalgae as green cell factories, vol 616. Landes Bioscience, pp 46–53
Helliwell KE, Scaife MA, Sasso S, Araujo AP, Purton S, Smith AG (2014) Unraveling vitamin
B12-responsive gene regulation in algae. Plant Physiol 165(1):388–397
Hennig S, van de Linde S, Lummer M, Simonis M, Huser T, Sauer M (2015) Instant live-cell
super-resolution imaging of cellular structures by nanoinjection of fluorescent probes. Nano
Lett 15(2):1374–1381
Hu JL, Deng X, Shao N, Wang GH, Huang KY (2014) Rapid construction and screening of
artificial microRNA systems in Chlamydomonas reinhardtii. Plant J 79(6):1052–1064
Iwai M, Ikeda K, Shimojima M, Ohta H (2014) Enhancement of extraplastidic oil synthesis in
Chlamydomonas reinhardtii using a type-2 diacylglycerol acyltransferase with a phosphorus
starvation-inducible promoter. Plant Biotechnol J 12(6):808–819
Jiang WZ, Brueggeman AJ, Horken KM, Plucinak TM, Weeks DP (2014) Successful transient
expression of Cas9 and single guide RNA genes in Chlamydomonas reinhardtii. Eukaryot Cell
13(11):1465–1469
Jinek M, Chylinski K, Fonfara I, Hauer M, Doudna JA, Charpentier E (2012) A programmable dual-
RNA-guided DNA endonuclease in adaptive bacterial immunity. Science 337(6096):816–821
Jinkerson RE, Jonikas MC (2015) Molecular techniques to interrogate and edit the
Chlamydomonas nuclear genome. Plant J. doi:10.1111/tpj.12801
Joint Genome Institute (2015) Phytozome v10.1, Chlamydomonas reinhardtii v5.5, US Department
of Energy. http://phytozome.jgi.doe.gov.
Kindle KL (1990) High-frequency nuclear transformation of Chlamydomonas reinhardtii. Proc
Natl Acad Sci USA 87(3):1228–1232
Kindle KL, Schnell RA, Fernandez E, Lefebvre PA (1989) Stable nuclear transformation of
Chlamydomonas using the Chlamydomonas gene for nitrate reductase. J Cell Biol 109
(6):2589–2601
Klein TM, Wolf ED, Wu R, Sanford JC (1987) High-velocity microprojectiles for delivering
nucleic-acids into living cells. Nature 327(6117):70–73
Kleinstiver BP, Pattanayak V, Prew MS, Tsai SQ, Nguyen NT, Zheng Z, Joung JK (2016) High-
fidelity CRISPR-Cas9 nucleases with no detectable genome-wide off-target effects. Nature
Koblenz B, Lechtreck KF (2005) The NIT1 promoter allows inducible and reversible silencing of
centrin in Chlamydomonas reinhardtii. Eukaryot Cell 4(11):1959–1962
Kong F, Yamasaki T, Kurniasih SD, Hou L, Li X, Ivanova N, Okada S, Ohama T (2015) Robust
expression of heterologous genes by selection marker fusion system in improved
Chlamydomonas strains. J Biosci Bioeng. doi:10.1016/j.jbiosc.2015.01.005
Kovar JL, Zhang J, Funke RP, Weeks DP (2002) Molecular analysis of the acetolactate synthase
gene of Chlamydomonas reinhardtii and development of a genetically engineered gene as a
dominant selectable marker for genetic transformation. Plant J 29(1):109–117
Kozminski KG, Diener DR, Rosenbaum JL (1993) High level expression of nonacetylatable alpha-
tubulin in Chlamydomonas reinhardtii. Cell Motil Cytoskeleton 25(2):158–170
54 J.H. Mussgnug
Kucho K, Ohyama K, Fukuzawa H (1999) CO2-responsive transcriptional regulation of CAH1

encoding carbonic anhydrase is mediated by enhancer and silencer regions in Chlamydomonas
reinhardtii. Plant Physiol 121(4):1329–1337
Kumar SV, Misquitta RW, Reddy VS, Rao BJ, Rajam MV (2004) Genetic transformation of the
green alga Chlamydomonas reinhardtii by Agrobacterium tumefaciens. Plant Sci 166
(3):731–738
Ladygin VG, Butanaev AM (2002) Transformation of Chlamydomonas reinhardtii CW-15 with
the hygromycin phosphotransferase gene as a selective marker. Genetika 38(9):1196–1202
Lambertz C, Hemschemeier A, Happe T (2010) Anaerobic expression of the ferredoxin-encoding
FDX5 gene of Chlamydomonas reinhardtii is regulated by the Crr1 transcription factor.
Eukaryot Cell 9(11):1747–1754
Lauersen KJ, Berger H, Mussgnug JH, Kruse O (2013) Efficient recombinant protein production
and secretion from nuclear transgenes in Chlamydomonas reinhardtii. J Biotechnol 167
(2):101–110
Lauersen KJ, Kruse O, Mussgnug JH (2015) Targeted expression of nuclear transgenes in
Chlamydomonas reinhardtii with a versatile, modular vector toolkit. Appl Microbiol
Biotechnol 99:3491–3503
Lauersen KJ, Willamme R, Coosemans N, Joris M, Kruse O, Remacle C (2016) Peroxisomal
microbodies are at the crossroads of acetate assimilation in the green microalga
Chlamydomonas reinhardtii. Algal Res 16:266–274
Leisinger U, Rufenacht K, Fischer B, Pesaro M, Spengler A, Zehnder AJB, Eggen RIL (2001) The
glutathione peroxidase homologous gene from Chlamydomonas reinhardtii is transcriptionally
up-regulated by singlet oxygen. Plant Mol Biol 46(4):395–408
Li XB, Zhang R, Patena W, Gang SS, Blum SR, Ivanova N, Yue R, Robertson JM, Lefebvre PA,
enables reverse genetics studies of biological processes in Chlamydomonas reinhardtii. Plant
Cell 28(2):367–387
Lodha M, Schulz-Raffelt M, Schroda M (2008) A new assay for promoter analysis in
Chlamydomonas reveals roles for heat shock elements and the TATA box in HSP70A
promoter-mediated activation of transgene expression. Eukaryot Cell 7(1):172–176
Lumbreras V, Stevens DR, Purton S (1998) Efficient foreign gene expression in Chlamydomonas
reinhardtii mediated by an endogenous intron. Plant J 14(4):441–447
Matsuo T, Onai K, Okamoto K, Minagawa J, Ishiura M (2006) Real-time monitoring of chloro-
plast gene expression by a luciferase reporter: evidence for nuclear regulation of chloroplast
circadian period. Mol Cell Biol 26(3):863–870
Mayfield SP, Kindle KL (1990) Stable nuclear transformation of Chlamydomonas reinhardtii by
using a C. reinhardtii gene as the selectable marker. Proc Natl Acad Sci USA 87(6):2087–2091
Mayfield SP, Schultz J (2004) Development of a luciferase reporter gene, luxCt, for
Chlamydomonas reinhardtii chloroplast. Plant J 37(3):449–458
McCallum CM, Comai L, Greene EA, Henikoff S (2000) Targeted screening for induced mutations.
Nat Biotechnol 18(4):455–457
McCarthy SS, Kobayashi MC, Niyogi KK (2004) White mutants of Chlamydomonas reinhardtii
are defective in phytoene synthase. Genetics 168(3):1249–1257
Merchant S, Hill K, Howe G (1991) Dynamic interplay between two copper-titrating components
in the transcriptional regulation of cyt c6. EMBO J 10(6):1383–1389
Merchant SS, Prochnik SE, Vallon O, Harris EH, Karpowicz SJ, Witman GB, Terry A, Salamov A,
Fritz-Laylin LK, Marechal-Drouard L, Marshall WF, Qu LH, Nelson DR, Sanderfoot AA,
Spalding MH, Kapitonov VV, Ren QH, Ferris P, Lindquist E, Shapiro H, Lucas SM,
Grimwood J, Schmutz J, Cardol P, Cerutti H, Chanfreau G, Chen CL, Cognat V, Croft MT,
Dent R, Dutcher S, Fernandez E, Fukuzawa H, Gonzalez-Ballester D, Gonzalez-Halphen D,
Hallmann A, Hanikenne M, Hippler M, Inwood W, Jabbari K, Kalanon M, Kuras R, Lefebvre
PA, Lemaire SD, Lobanov AV, Lohr M, Manuell A, Meir I, Mets L, Mittag M, Mittelmeier T,
Moroney JV, Moseley J, Napoli C, Nedelcu AM, Niyogi K, Novoselov SV, Paulsen IT, Pazour G,
Purton S, Ral JP, Riano-Pachon DM, Riekhof W, Rymarquis L, Schroda M, Stern D, Umen J,
Willows R, Wilson N, Zimmer SL, Allmer J, Balk J, Bisova K, Chen CJ, Elias M, Gendler K,
Hauser C, Lamb MR, Ledford H, Long JC, Minagawa J, Page MD, Pan JM, Pootakham W, Roje S,
Rose A, Stahlberg E, Terauchi AM, Yang PF, Ball S, Bowler C, Dieckmann CL, Gladyshev VN,
Green P, Jorgensen R, Mayfield S, Mueller-Roeber B, Rajamani S, Sayre RT, Brokstein P,
Dubchak I, Goodstein D, Hornick L, Huang YW, Jhaveri J, Luo YG, Martinez D, Ngau WCA,
Otillar B, Poliakov A, Porter A, Szajkowski L, Werner G, Zhou KM, Grigoriev IV, Rokhsar DS,
Grossman AR, Annotation C, Team JA (2007) The Chlamydomonas genome reveals the evolution
of key animal and plant functions. Science 318(5848):245–251
Meslet-Cladiere L, Vallon O (2011) Novel shuttle markers for nuclear transformation of the green
alga Chlamydomonas reinhardtii. Eukaryot Cell 10(12):1670–1678
Minko I, Holloway SP, Nikaido S, Carter M, Odom OW, Johnson CH, Herrin DL (1999) Renilla
luciferase as a vital reporter for chloroplast gene expression in Chlamydomonas. Mol Gen
Genet 262(3):421–425
Molnar A, Bassett A, Thuenemann E, Schwach F, Karkare S, Ossowski S, Weigel D, Baulcombe
D (2009) Highly specific gene silencing by artificial microRNAs in the unicellular alga
Chlamydomonas reinhardtii. Plant J 58(1):165–174
Mussgnug JH (2015) Genetic tools and techniques for Chlamydomonas reinhardtii. Appl
Microbiol Biotechnol 99(13):5407–5418
Mussgnug JH, Wobbe L, Elles I, Claus C, Hamilton M, Fink A, Kahmann U, Kapazoglou A,
Mullineaux CW, Hippler M, Nickelsen J, Nixon PJ, Kruse O (2005) NAB1 is an RNA binding
protein involved in the light-regulated differential expression of the light-harvesting antenna of
Chlamydomonas reinhardtii. Plant Cell 17(12):3409–3421
Mussgnug JH, Thomas-Hall S, Rupprecht J, Foo A, Klassen V, McDowall A, Schenk PM,
Kruse O, Hankamer B (2007) Engineering photosynthetic light capture: impacts on improved
solar energy to biomass conversion. Plant Biotechnol J 5(6):802–814
Nelson JAE, Lefebvre PA (1995) Targeted disruption of the NIT8 gene in Chlamydomonas
reinhardtii. Mol Cell Biol 15(10):5762–5769
Nelson JAE, Savereide PB, Lefebvre PA (1994) The Cry1 gene in Chlamydomonas reinhardtii:
structure and use as a dominant selectable marker for nuclear transformation. Mol Cell Biol 14
(6):4011–4019
Neumann E, Schaefer-Ridder M, Wang Y, Hofschneider PH (1982) Gene transfer into mouse
lyoma cells by electroporation in high electric fields. EMBO J 1(7):841–845
Neupert J, Karcher D, Bock R (2009) Generation of Chlamydomonas strains that efficiently
express nuclear transgenes. Plant J 57(6):1140–1150
Nichols KM, Rikmenspoel R (1978) Control of flagellar motion in Chlamydomonas and Euglena
by mechanical microinjection of Mg2+ and Ca2+ and by electric current injection. J Cell Sci
29:233–247
Nickelsen J, van Dillewijn J, Rahire M, Rochaix JD (1994) Determinants for stability of the
chloroplast psbD RNA are located within its short leader region in Chlamydomonas reinhardtii.
EMBO J 13(13):3182–3191
Nybom N (1953) Some experiences from mutation experiments in Chlamydomonas. Hereditas 39
(1–2):317–324
Nymark M, Sharma AK, Sparstad T, Bones AM, Winge P (2016) A CRISPR/Cas9 system adapted
for gene editing in marine algae. Sci Rep 6:24951
Ohresser M, Matagne RF, Loppes R (1997) Expression of the arylsulphatase reporter gene under
the control of the nit1 promoter in Chlamydomonas reinhardtii. Curr Genet 31(3):264–271
Ossowski S, Schwab R, Weigel D (2008) Gene silencing in plants using artificial microRNAs and
other small RNAs. Plant J 53(4):674–690
Pape M, Lambertz C, Happe T, Hemschemeier A (2012) Differential expression of the
Chlamydomonas [FeFe]-hydrogenase-encoding HYDA1 gene is regulated by the COPPER
RESPONSE REGULATOR1. Plant Physiol 159(4):1700–1712
56 J.H. Mussgnug
Park S, Lee Y, Lee JH, Jin E (2013) Expression of the high light-inducible Dunaliella LIP
promoter in Chlamydomonas reinhardtii. Planta 238(6):1147–1156
Porto MS, Pinheiro MPN, Batista VGL, dos Santos RC, Melo PD, de Lima LM (2014) Plant
promoters: an approach of structure and function. Mol Biotechnol 56(1):38–49
Quinn JM, Kropat J, Merchant S (2003) Copper response element and Crr1-dependent Ni2+-respon-
sive promoter for induced, reversible gene expression in Chlamydomonas reinhardtii. Eukaryot
Cell 2(5):995–1002
Ramundo S, Rahire M, Schaad O, Rochaix JD (2013) Repression of essential chloroplast genes
reveals new signaling pathways and regulatory feedback loops in Chlamydomonas. Plant Cell
25(1):167–186
Ran FA, Cong L, Yan WX, Scott DA, Gootenberg JS, Kriz AJ, Zetsche B, Shalem O, Wu XB,
Makarova KS, Koonin EV, Sharp PA, Zhang F (2015) In vivo genome editing using Staphy-
lococcus aureus Cas9. Nature 520(7546):186–191
Randolph-Anderson BL, Sato R, Johnson AM, Harris EH, Hauser CR, Oeda K, Ishige F, Nishio S,
Gillham NW, Boynton JE (1998) Isolation and characterization of a mutant
protoporphyrinogen oxidase gene from Chlamydomonas reinhardtii conferring resistance to
porphyric herbicides. Plant Mol Biol 38(5):839–859
Rasala BA, Mayfield SP (2015) Photosynthetic biomanufacturing in green algae; production of
recombinant proteins for industrial, nutritional, and medical uses. Photosynth Res 123
(3):227–239
Rasala BA, Lee PA, Shen ZX, Briggs SP, Mendez M, Mayfield SP (2012) Robust expression and
secretion of Xylanase1 in Chlamydomonas reinhardtii by fusion to a selection gene and
processing with the FMDV 2A peptide. PLoS One 7(8). doi:10.1371/journal.pone.0043349
Rasala BA, Barrera DJ, Ng J, Plucinak TM, Rosenberg JN, Weeks DP, Oyler GA, Peterson TC,
Haerizadeh F, Mayfield SP (2013) Expanding the spectral palette of fluorescent proteins for the
green microalga Chlamydomonas reinhardtii. Plant J 74(4):545–556
Rasala BA, Chao SS, Pier M, Barrera DJ, Mayfield SP (2014) Enhanced genetic tools for engineering
multigene traits into green algae. PLoS One 9(4). doi:10.1371/journal.pone.0094028
Remacle C, Cline S, Boutaffala L, Gabilly S, Larosa V, Barbieri MR, Coosemans N, Hamel PP
(2009) The ARG9 gene encodes the plastid-resident N-acetyl ornithine aminotransferase in the
green alga Chlamydomonas reinhardtii. Eukaryot Cell 8(9):1460–1463
Rhaese HJ, Boetker NK (1973) The molecular basis of mutagenesis by methyl and ethyl
methanesulfonates. Eur J Biochem 32(1):166–172
Rochaix JD, van Dillewijn J (1982) Transformation of the green alga Chlamydomonas reinhardtii
with yeast DNA. Nature 296(5852):70–72
Rohr J, Sarkar N, Balenger S, Jeong BR, Cerutti H (2004) Tandem inverted repeat system for
selection of effective transgenic RNAi strains in Chlamydomonas. Plant J 40(4):611–621
Ruecker O, Zillner K, Groebner-Ferreira R, Heitzer M (2008) Gaussia-luciferase as a sensitive
reporter gene for monitoring promoter activity in the nucleus of the green alga
Chlamydomonas reinhardtii. Mol Gen Genomics 280(2):153–162
Sawyer AL, Hankamer BD, Ross IL (2015) Sulphur responsiveness of the Chlamydomonas
reinhardtii LHCBM9 promoter. Planta. doi:10.1007/s00425-015-2249-9
Scaife MA, Nguyen GT, Rico J, Lambert D, Helliwell KE, Smith AG (2015) Establishing
Chlamydomonas reinhardtii as an industrial biotechnology host. Plant J. doi:10.1111/tpj.12781
Schierenbeck L, Ries D, Rogge K, Grewe S, Weisshaar B, Kruse O (2015) Fast forward genetics to
identify mutations causing a high light tolerant phenotype in Chlamydomonas reinhardtii by
whole-genome-sequencing. BMC Genomics 16(1):57
Schmollinger S, Strenkert D, Schroda M (2010) An inducible artificial microRNA system for
Chlamydomonas reinhardtii confirms a key role for heat shock factor 1 in regulating
thermotolerance. Curr Genet 56(4):383–389
Schnell RA, Lefebvre PA (1993) Isolation of the Chlamydomonas regulatory gene NIT2 by
transposon tagging. Genetics 134(3):737–747
Schroda M (2006) RNA silencing in Chlamydomonas: mechanisms and tools. Curr Genet 49
(2):69–84
Schroda M, Vallon O, Wollman FA, Beck CF (1999) A chloroplast-targeted heat shock protein
70 (HSP70) contributes to the photoprotection and repair of photosystem II during and after
photoinhibition. Plant Cell 11(6):1165–1178
Schroda M, Blocker D, Beck CF (2000) The HSP70A promoter as a tool for the improved
expression of transgenes in Chlamydomonas. Plant J 21(2):121–131
Scranton MA, Ostrand JT, Georgianna DR, Lofgren SM, Li D, Ellis RC, Carruthers DN, Dräger A,
Masica DL, Mayfield SP (2016) Synthetic promoters capable of driving robust nuclear gene
expression in the green alga Chlamydomonas reinhardtii. Algal Res 15:135–142
Shao N, Bock R (2008) A codon-optimized luciferase from Gaussia princeps facilitates the in vivo
monitoring of gene expression in the model alga Chlamydomonas reinhardtii. Curr Genet 53
(6):381–388
Shen YJ, Liu YS, Liu L, Liang C, Li QSQ (2008) Unique features of nuclear mRNA Poly
(A) signals and alternative polyadenylation in Chlamydomonas reinhardtii. Genetics 179
(1):167–176
Shimogawara K, Fujiwara S, Grossman A, Usuda H (1998) High-efficiency transformation of
Chlamydomonas reinhardtii by electroporation. Genetics 148(4):1821–1828
Shin SE, Lim JM, Koh HG, Kim EK, Kang NK, Jeon S, Kwon S, Shin WS, Lee B, Hwangbo K,
Kim J, Ye SH, Yun JY, Seo H, Oh HM, Kim KJ, Kim JS, Jeong WJ, Chang YK, Jeong BR
(2016) CRISPR/Cas9-induced knockout and knock-in mutations in Chlamydomonas
reinhardtii. Sci Rep 6:27810
Sizova IA, Lapina TV, Frolova ON, Alexandrova NN, Akopiants KE, Danilenko VN (1996)
Stable nuclear transformation of Chlamydomonas reinhardtii with a Streptomyces rimosus
gene as the selective marker. Gene 181(1–2):13–18
Sizova I, Fuhrmann M, Hegemann P (2001) A Streptomyces rimosus aphVIII gene coding for a
new type phosphotransferase provides stable antibiotic resistance to Chlamydomonas
reinhardtii. Gene 277(1–2):221–229
Sizova I, Greiner A, Awasthi M, Kateriya S, Hegemann P (2013) Nuclear gene targeting in
Chlamydomonas using engineered zinc-finger nucleases. Plant J 73(5):873–882
Slaymaker IM, Gao L, Zetsche B, Scott DA, Yan WX, Zhang F (2016) Rationally engineered Cas9
nucleases with improved specificity. Science 351(6268):84–88
Smart EJ, Selman BR (1993) Complementation of a Chlamydomonas reinhardtii mutant defective
in the nuclear gene encoding the chloroplast coupling factor 1 (CF1) gamma-subunit (atpC).
J Bioenerg Biomembr 25(3):275–284
Sodeinde OA, Kindle KL (1993) Homologous recombination in the nuclear genome of
Chlamydomonas reinhardtii. Proc Natl Acad Sci USA 90(19):9199–9203
Specht EA, Nour-Eldin HH, Hoang KT, Mayfield SP (2014) An improved ARS2-derived nuclear
reporter enhances the efficiency and ease of genetic engineering in Chlamydomonas.
Biotechnol J 10(3):473–479
Stevens DR, Rochaix JD, Purton S (1996) The bacterial phleomycin resistance gene ble as a
dominant selectable marker in Chlamydomonas. Mol Gen Genet 251(1):23–30
Strauss C, Mussgnug JH, Kruse O (2001) Ligation-mediated suppression-PCR as a powerful tool
to analyse nuclear gene sequences in the green alga Chlamydomonas reinhardtii. Photosynth
Res 70(3):311–320
Strenkert D, Schmollinger S, Schroda M (2013) Heat shock factor 1 counteracts epigenetic silencing of
nuclear transgenes in Chlamydomonas reinhardtii. Nucleic Acids Res 41(10):5273–5289
Surzycki R, Cournac L, Peltier G, Rochaix JD (2007) Potential for hydrogen production with inducible
chloroplast gene expression in Chlamydomonas. Proc Natl Acad Sci USA 104(44):17548–17553
Tang DKH, Qiao SY, Wu M (1995) Insertion mutagenesis of Chlamydomonas reinhardtii by
electroporation and heterologous DNA. Biochem Mol Biol Int 36(5):1025–1035
58 J.H. Mussgnug
Tardif M, Atteia A, Specht M, Cogne G, Rolland N, Brugiere S, Hippler M, Ferro M, Bruley C,

Peltier G, Vallon O, Cournac L (2012) PredAlgo: a new subcellular localization prediction tool
dedicated to green algae. Mol Biol Evol 29(12):3625–3639
Terashima M, Freeman ES, Jinkerson RE, Jonikas MC (2015) A fluorescence-activated cell sorting-
based strategy for rapid isolation of high-lipid Chlamydomonas mutants. Plant J 81(1):147–159
Vila M, Diaz-Santos E, de la Vega M, Rodriguez H, Vargas A, Leon R (2012) Promoter trapping in
microalgae using the antibiotic paromomycin as selective agent. Mar Drugs 10(12):2749–2765
Voytsekh O, Seitz SB, Iliev D, Mittag M (2008) Both subunits of the circadian RNA-binding
protein CHLAMY1 can integrate temperature information. Plant Physiol 147(4):2179–2193
Walker TL, Becker DK, Collet C (2005) Characterisation of the Dunaliella tertiolecta RbcS genes
and their promoter activity in Chlamydomonas reinhardtii. Plant Cell Rep 23(10–11):727–735
Wang Q, Lu Y, Xin Y, Wei L, Huang S, Xu J (2016) Genome editing of model oleaginous
microalgae Nannochloropsis spp. by CRISPR/Cas9. Plant J. doi:10.1111/tpj.13307
Yarmush ML, Golberg A, Sersa G, Kotnik T, Miklavcic D (2014) Electroporation-based technologies
for medicine: principles, applications, and challenges. Annu Rev Biomed Eng 16:295–320
Zetsche B, Gootenberg JS, Abudayyeh OO, Slaymaker IM, Makarova KS, Essletzbichler P, Volz SE,
Joung J, van der Oost J, Regev A, Koonin EV, Zhang F (2015) Cpf1 Is a single RNA-guided
endonuclease of a class 2 CRISPR-Cas system. Cell 163(3):759–771
Zhang D, Lefebvre PA (1997) FAR1, a negative regulatory locus required for the repression of the
nitrate reductase gene in Chlamydomonas reinhardtii. Genetics 146(1):121–133
Zhang R, Patena W, Armbruster U, Gang SS, Blum SR, Jonikas MC (2014) High-throughput
genotyping of green algal mutants reveals random distribution of mutagenic insertion sites and
endonucleolytic cleavage of transforming DNA. Plant Cell 26(4):1398–1409
Zhao T, Wang W, Bai X, Qi YJ (2009) Gene silencing by artificial microRNAs in Chlamydomonas.
Plant J 58(1):157–164
Zhao ZX, Wu XH, Kumar PKR, Dong M, Ji GL, Li QSQ, Liang C (2014) Bioinformatics analysis of
alternative polyadenylation in green alga Chlamydomonas reinhardtii using transcriptome
sequences from three different sequencing platforms. G3 Genes Genomes Genetics 4(5):871–883
Zorin B, Hegemann P, Sizova I (2005) Nuclear-gene targeting by using single-stranded DNA avoids
illegitimate DNA integration in Chlamydomonas reinhardtii. Eukaryot Cell 4(7):1264–1272
Zorin B, Lu YH, Sizova I, Hegemann P (2009) Nuclear gene targeting in Chlamydomonas as
exemplified by disruption of the PHOT gene. Gene 432(1–2):91–96
Mitochondrial Bioenergetics Pathways
in Chlamydomonas
Simon Massoz, Pierre Cardol, Diego González-Halphen,

and Claire Remacle
Abstract Mitochondrion is the site where the Krebs cycle and oxidative phosphor-
ylation (OXPHOS) take place. After a brief overview of Krebs cycle and acetate
metabolism in Chlamydomonas, this chapter focuses on OXPHOS components.
OXPHOS is composed of five major multiprotein complexes: NADH:ubiquinone
oxidoreductase (complex I), succinate dehydrogenase (complex II), ubiquinone:
cytochrome c oxidoreductase (complex III), cytochrome c oxidase (complex IV),
and ATP synthase. Three complexes (complexes I, III, and IV) pump protons from
the matrix to the intermembrane space (IMS) and build a gradient which is used by
ATP synthase to produce ATP. In Chlamydomonas and other eukaryotes, proteins
forming these complexes have a dual genetic origin. A few proteins, mostly
hydrophobic polypeptides, are mitochondrion-encoded, while the vast majority
are nucleus-encoded and imported from the cytoplasm. Here we will review our
current knowledge about these complexes.
List of Abbreviations
acetyl CoA Acetyl coenzyme A

ADP Adenosine diphosphate
ATP Adenosine triphosphate
BNC Binuclear center
FAD Flavin adenine dinucleotide
Fe-S Iron-sulfur
FMN Flavin mononucleotide
IMS Intermembrane space
NAD+ Nicotinamide adenine dinucleotide
S. Massoz • P. Cardol • C. Remacle (*)

Liège University, Genetics and Physiology of Microalgae, Chemin de la Vallée 4, 4000 Liège 1,
Belgium
D. González-Halphen
Universidad Nacional Autónoma de México, Instituto de Fisiologı́a Celular, México DF,
Mexico

60 S. Massoz et al.
NADH Reduced form of nicotinamide adenine dinucleotide

NADP+ Nicotinamide adenine dinucleotide phosphate
NADPH Reduced form of nicotinamide adenine dinucleotide phosphate
OXPHOS Oxidative phosphorylation
Q Ubiquinone
QH2 Ubiquinol
Pi Inorganic phosphate
PLS Proton-loading site
ROS Reactive oxygen species
1 Krebs Cycle and Acetate Metabolism
The mitochondrion houses the Krebs cycle in the matrix and OXPHOS in the inner
mitochondrial membrane (Fig. 1). Pyruvate, the end product of glycolysis, is
imported inside the mitochondria by crossing both the outer and the inner mitochon-
drial membrane. Similar to most ions and metabolites, pyruvate is hypothesized to
cross the outer membrane through the voltage-dependent anion channel (VDAC)
based on the fact that humans deficient of VDAC1 show impaired pyruvate oxida-
tion and ATP production (McCommis and Finck 2015). In Chlamydomonas, two
VDAC proteins have been identified in the genome, ASC1 and ASC2, sharing 64%
of sequence identity to each other (Salinas, unpublished). In contrast, specific
pyruvate carriers for the inner mitochondrial membrane have been identified in
yeast, Drosophila, and humans (Bricker et al. 2012). Accordingly, two genes
described as encoding mitochondrial pyruvate carriers are present in version 5.5 of
the Chlamydomonas genome (https://phytozome.jgi.doe.gov): Cre02.g113100.t1.1
and Cre10.g433400.t1.1. Once pyruvate enters the matrix, it is converted into acetyl
CoA by the mitochondrial pyruvate dehydrogenase complex (PDH, composed of
three subunits encoded by PDC1, PDC2, and PDH1 genes; Fig. 1). Acetyl CoA then
enters the Krebs cycle, consisting of eight mitochondrial enzymes, whose presence
has been confirmed in the mitochondria by proteomic analysis (Atteia et al. 2009).
The following genes encode the components of Chlamydomonas Krebs cycle
(Atteia et al. 2009): (1) Fumarase (FUM, Fig. 1) is encoded by FUM1; (2) malate
dehydrogenase (MDH, Fig. 1) is represented by two isoforms encoded by the MDH3
and MDH4 genes; (3) citrate synthase (CIS, Fig. 1) is represented by one isoform
encoded by CIS1; (4) aconitase (ACH, Fig. 1) is represented by the lone isoform
encoded by ACH1; (5) isocitrate dehydrogenase (IDH, Fig. 1) is represented by three
isoforms, two are NAD-dependent and encoded by IDH1 and IDH2, while one
isoform encoded by IDH3 is NADP-dependent; (6) the 2-oxoglutarate dehydroge-
nase complex (OGDH, Fig. 1) is composed of three subunits, encoded by OGD1,
OGD2, and OGD3; (7) succinyl-CoA synthase (SCS, Fig. 1) is composed of two
subunits encoded by SCLA1 and SCLB1 genes; (8) succinate dehydrogenase (com-
plex II/SDH, Fig. 1) will be described in the OXPHOS section.
Exchange of metabolites between cellular compartments involves different
transporters (Fig. 1). Thirteen genes corresponding to mitochondrial substrate
complex III
Cyt c RIP1 C1 2 UQ + 4 H+ complex II / SDH complex I IMS
COB 2 UQH2 ND1 ND6 ND4
SDH 3/4
UQ UQ ND3
UQH2 ND4L ND2 ND5
QCR1 SDH2 NUO7
QCR2 UQH2 UQH2 PSST
UQ + 2 H+ CAG
SDH1 NUO9 4 H+
0
FAD FADH2 TYKY
acetate
complex IV 75 kD 24kD
51 kD
COX2 MITOCHONDRION
4 H+ + O2 acetate acetate
succinate fumarate NADH NAD+ 2 H2O
COX1 GFY
2 H2O O2
SCS FUM ATP AOX
4 H+ ACS
COX3
succinyl-CoA malate UQH2 UQ
ATP synthase NADH
CO2
ATP MDH NADH acetyl-CoA Type II NDH
α3/β3
OGDH NADH NADH
c γ/δ/ε
oxoglutarate oxaloacetate CO2 PDH NAD+
CO2
NADH ATP CIS pyruvate
H+ IDH AAT pyruvate
isocitrate citrate malate
oxoglutarate
ATP ADP + Pi
ACH aspartate glutamate
MITC14
PEROXISOME glutamate malate

Mitochondrial Bioenergetics Pathways in Chlamydomonas
aspartate
CIS oxoglutarate MDH
AAT NAD+
Cell
NADH
oxaloacetate citrate isocitrate isocitrate succinate oxaloacetate membrane
NADH ACH
MDH ICL
malate glyoxylate glyoxylate
MAS Catabolism
ATP CYTOSOL
acetyl-CoA acetate acetate Anabolism
ACS
Fig. 1 General scheme of mitochondrial carbon metabolism in C. reinhardtii. OXPHOS: only bacterial core subunits and Chlamydomonas-specific modules
(green) are represented. Only H+ involved in ΔpH (red) are depicted in complexes I, III, and IV. AAT aspartate aminotransferase, ACH aconitase, ACS acetyl
CoA synthase, CIS citrate synthase, FUM fumarase, GFY putative acetate transporters, ICL isocitrate lyase, IDH isocitrate dehydrogenase, MAS malate
61
synthase, MDH malate dehydrogenase, MITC14 oxoglutarate/malate carrier, OGDH 2-oxoglutarate dehydrogenase, PDH pyruvate dehydrogenase complex,
SCS succinyl coenzyme A synthetase
62 S. Massoz et al.
carrier proteins (MITC) are identified in the Phytozome 5.5 version of

Chlamydomonas nuclear genome. In particular, MITC10, 11, and 14 have been
found by proteomics analysis of mitochondria (Atteia et al. 2009). MITC14 codes
for a putative 2-oxoglutarate/malate carrier.
One particularity of Chlamydomonas is its ability to sustain heterotrophic growth
(growth in the dark) through acetate assimilation. Five putative acetate transporters
belonging to the GRP1/FUN34/Yaa family (GFY, Fig. 1) have been recently iden-
tified in Chlamydomonas (Goodenough et al. 2014) based on homology to fungal
acetate permease A. These proteins bear six transmembrane segments, suggesting
membrane localization. Once inside the cell, acetate is metabolized into acetyl CoA
by acetyl CoA synthase. Three isoforms of acetyl CoA synthase are present: ACS1 is
cytosolic (Lauersen et al. 2016), ACS2 is chloroplastic (Terashima et al. 2010),
while ACS3 would be colocalized in mitochondria (Atteia et al. 2009) and perox-
isomes (Lauersen et al. 2016) (Fig. 1). Acetyl CoA can be used in the glyoxylate
cycle to fuel gluconeogenesis and other anabolic pathways or in the Krebs cycle to
produce NADH for the respiratory chain and ATP production, both processes being
necessary for effective growth in the dark (Salinas et al. 2014; Plancke et al. 2014).
Indeed, respiratory-deficient mutants and the recently characterized mutant deficient
of isocitrate lyase (icl1), one of the two specific enzymes of the glyoxylate cycle
(Fig. 1), are unable to grow under heterotrophic conditions. The localization of the
enzymes of the glyoxylate cycle has been recently elucidated (Lauersen et al. 2016).
Five of the six enzymes associated with the glyoxylate cycle are located within
peroxisomal microbodies: one of the isoforms of malate dehydrogenase (MDH1),
citrate synthase (CIS2), and acetyl CoA synthase (ACS3) and the lone form of
malate synthase (MAS1) and of aconitase (ACH1), which defines for the first time
a central role of peroxisomal microbodies in acetate assimilation. Only the single
form of isocitrate lyase (ICL1) was found in the cytosol, which implies shuttling of
metabolites such as isocitrate, succinate, and glyoxylate between peroxisomal
microbodies, cytosol, and mitochondria (Fig. 1). Pore-like membrane structures
and specific transporters would permit these exchanges, but the molecular identity
of such channel proteins remains undetermined (Kunze and Hartig 2013).
2 OXPHOS
2.1 Complex I
Complex I (EC 1.6.5.3), the first complex of OXPHOS, catalyzes the reaction
½NADH þ Hþ þ Q þ 4 Hþ matrix ) NADþ þ QH2 þ 4 Hþ IMS ðQ ¼ ubiquinoneÞ
In all organisms investigated so far, complex I is an L-shaped multiprotein

complex (Vinothkumar et al. 2014) with a molecular mass of ~1 MDa and
Mitochondrial Bioenergetics Pathways in Chlamydomonas 63
45 subunits (in humans), out of which 41 are conserved among eukaryotes (Cardol
2011). Fourteen of these subunits represent the core of the complex as they form the
structure of the most simplistic bacterial complex I (type I NDH) (Efremov et al.
2010; Berrisford et al. 2016) and are conserved in all eukaryotic complex I. Among
these 14 core subunits, the mitochondrially encoded subunits ND1, ND2, ND4,
ND5, ND6, ND3 (NUO3), and ND4L (NUO11) form the membrane arm of the
complex. The nucleus-encoded 75 kDa (NUOS1), 51 kDa (NUO6), 24 kDa
(NUO5), 49 kDa (NUO7), 30 kDa (NUO9), TYKY (NUO8), and PSST (NUO10)
subunits form the matrix part of the complex (bovine and Chlamydomonas nomen-
clature). In addition to these core subunits, around 30 supernumerary subunits are
present in the eukaryotic complex I. Though their role remains unclear, these
subunits are thought to stabilize and protect complex I (Hirst et al. 2003).
In complex I, electrons are channeled from NADH to a ubiquinone molecule
through a flavin mononucleotide (FMN) and seven iron-sulfur (Fe-S) clusters
named N3, N1b, N4, N5, N6a, N6b, and N2. An eighth Fe-S cluster is located
near the FMN, named N1a, and thought to serve as an electron store meant to avoid
an excessive reactive oxygen species (ROS) production (Zickermann et al. 2015).
These Fe-S clusters are mostly reduced under physiological conditions (Kotlyar
et al. 1990). The FMN with a midpoint redox potential at pH 7 of ~ 340 mV serves
as the first electron acceptor from NADH; the N3, N1b, N4, N5, N6a, and N6b are
equipotential at 250 mV and serve as a path for electron transport (Ohnishi
1998; Brandt 2011). The high-potential N2 cluster (120 mV) serves as final
electron acceptor and catalyzes electron transfer to the ubiquinone molecule.
The prokaryotic core complex I is divided into modules based on function and
position within the complex (Fig. 2). The N module, located at the most distal part
of the matrix arm, is related to NAD+-reducing hydrogenases (Friedrich and Weiss
1997). It is responsible for NADH oxidation and is composed of the 75 kDa,
51 kDa, and 24 kDa subunits. The 51 kDa subunit bears the FMN and the N1b
Fe-S cluster. The 24 kDa bears the N1a Fe-S cluster. The large 75 kDa bears the N3,
N4, and N5 Fe-S clusters.
The Q module, or quinone reduction module, is composed of the 49 kDa,
30 kDa, TYKY, and PSST subunits. This module allows electron transfer to the
ubiquinone through the N6a and N6b Fe-S clusters located on the TYKY subunit
and through N2 reaction center cluster. The 49 kDa, TYKY, and PSST subunits are
thought to be derived from a Ni-Fe-type hydrogenase (Friedrich and Weiss 1997;
Vignais and Billoud 2007) where the proximal Fe-S cluster from the Ni-Fe reaction
center became the current N2 cluster (Kerscher et al. 2001). It is interesting to note
that the N2 cluster, long thought to be harbored by the 49 kDa and PSST subunits,
has been shown to be only linked to the PSST subunit (Sazanov and Hinchliffe
2006) with the 49 kDa subunit being at the interface of this cluster. Despite the fact
that the 49 kDa and 30 kDa proteins are the only core subunits of the matrix arm that
do not provide ligands for cofactors, Chlamydomonas cells inactivated for their
expression fail to assemble whole complex I as also observed in all species
(Neurospora and E. coli) investigated so far (Schulte and Weiss 1995; Duarte
et al. 1998; Massoz et al. 2014).
64 S. Massoz et al.
Fig. 2 Hypothetical assembly model for complex I in Chlamydomonas. Nomenclature for

Chlamydomonas/humans is used for core subunits, and human nomenclature is used for assembly
factors. One name indicated means similar nomenclature. The plant-specific assembly factor
(GLDH) is also shown. Underlined assembly factors have been identified in humans, but no
homologs have been found in C. reinhardtii
The P module, often divided into the proximal (Pp) and distal region (Pd), is
composed of the remaining membrane subunits. The ND1, ND2, ND3, ND4L, and
ND6 subunits compose the Pp module (Fig. 1). The Pd module is composed of the ND4
and ND5 subunits. ND2, ND4, and ND5 are homologous to the E. coli cation/H+
antiporter MrpA/MrpD (Mathiesen and Hägerhäll 2002). These three subunits are
responsible for three out of four proton-pumping sites in complex I. The fourth site is
thought to be a channel located in the small ND subunits (ND3, ND4L, and ND6) with
maybe part of the ND1 subunit (Zickermann et al. 2015; Berrisford et al. 2016).
The current proton-pumping mechanism model for complex I is supported by
crystal structures in the bacterium Thermus thermophilus [reviewed in Sazanov
(2015)], the fungus Yarrowia lipolytica (Zickermann et al. 2015), and mammals
(Vinothkumar et al. 2014). The proton-pumping channels through the membrane
domain are distant from the redox-active groups mediating electron transfer through
the hydrophilic domain (Efremov and Sazanov 2011). As a consequence, the proton-
coupled electron transfer in complex I is expected to differ mechanistically from that
in other respiratory complexes. The current model for proton pumping is based on a
two-stage stabilization-change mechanism. This model proposes that the stabiliza-
tion of a negatively charged ubiquinone drives a conformational change causing
energy transmission to the membrane arm and resulting in proton pumping (Brandt
2011). This model combines computational simulations with biochemical experi-

ments based on bacterial complex I (Sharma et al. 2015; Hummer and Wikstr€om
2016). The bacterial complex I structure revealed an unusual ubiquinone-binding
cavity (Baradaran et al. 2013). The reduction of bound ubiquinone would create a
significant charge imbalance in the catalytic cavity. The charge imbalance would be
transmitted to the antiporter-like subunits by long-range conformational transmis-
sion. The antiporter-like subunits define a central flexible axis containing charged
and polar residues which extend from the ubiquinone-binding site at the junction
between the two main domains to the tip of the hydrophobic arm and thus represent a
hydrophilic central axis along the hydrophobic domain by which these concerted
conformational changes are transmitted. This would lead to changes in exposure to
solvent and in the pKa of key residues in the antiporter subunits, allowing proton
translocation (Berrisford et al. 2016; Hummer and Wikstr€om 2016). Displaced
ubiquinone would then be protonated. Once protonated, the charge imbalanced
would be compensated, and the newly formed ubiquinol would exit the cavity.
Complex I is the biggest complex of OXPHOS, with a large number of proteins
encoded in both the mitochondrial and the nuclear genomes. The assembly of
complex I is expected to involve of lot of chaperones and is not yet fully understood.
Because most data on complex I assembly were obtained in mammals, assembly
description will here be explained based on knowledge gained in humans. Thus,
human nomenclature will be used for the assembly description. As many other
OXPHOS complexes, complex I seems to be orderly assembled into subcomplexes
before these subcomplexes are assembled together to form the holoenzyme (Fig. 2).
The process starts with the assembly of the Q module containing NDUFS2,
NDUFS3, NDUFS8, and NDUFS7. This requires the intervention of at least four
factors named NDUFAF7, NDUFAF3, NDUFAF4, and NDUFAF6. NDUFAF7 is a
methyltransferase which methylates NDUFS2 (Rhein et al. 2013). NDUFAF6 has
been shown to stabilize NDUFS3 and ND1. NDUFAF3 and NDUFAF4 are
interdependent factors that recruit the subunits of the Q module to assemble them
with the ND1 membrane subunit (Saada et al. 2009), ND1 being itself stabilized by
the NDUFAF5/NDUFAF6 assembly factors. The Q module + ND1 represent an
early 400 kDa subcomplex. The second subcomplex (460 kDa) is composed of the
small ND subunits (ND3, ND4L, and ND6) and ND2 and assembles independently
from the 400 kDa. The four assembly factors NDUFAF1, ACAD9, TMEM126B,
and ECSIT (also called MCIA complex) are known to allow the assembly of this
460 kDa subcomplex [reviewed in Sánchez-Caballero et al. (2016)]. The two
subcomplexes merge together with the help of TIMMDC1 (Guarani et al. 2014)
into a 650 kDa subcomplex. Following these events, the assembled Pd module
merges with the rest of the subunits into a 830 kDa subcomplex stabilized by the
Foxred1 assembly factor. The assembled N module also proceeds to merge with the
now complete complex I with the help of the NDUFAF2 assembly factors (not
present in C. reinhardtii), though the role of the NDUFAF2 in N module assembly
has been contested in recent years (Kmita et al. 2015) where it was speculated to
potentially maintain the Q module into a proper conformation until later stage of
assembly. The completion of the assembly triggers the release of all remaining
66 S. Massoz et al.
assembly factors. Recombinant assembly factor Ind1 from humans (huInd1) (also
called NUBPL, Table 1) expressed in E. coli has been shown to bind Fe-S clusters
in vitro, and depletion of huInd1 was shown to be responsible for decreased complex
I assembly (Sheftel et al. 2009). These results point toward a role of huInd1 in Fe-S
cluster insertions. The apoptosis-inducing factor (AIF) also plays a role in complex I
assembly since cells depleted for this factor display decreased complex I activity
(Mimaki et al. 2012), though the exact role of this assembly factor remains unknown.
Whether plant complex I assembly follows the same pathway as in humans or not
is difficult to say. On the one hand, on the 14 assembly factors described in humans,
11 have putative homologs in Arabidopsis (Table 1), suggesting that similar patterns
of assembly could be found. On the other hand, as plant complex I contains an
additional gamma carbonic anhydrase module attached to the Pp module
(Sunderhaus et al. 2006; Klodmann et al. 2010; Fromm et al. 2016), this suggests
that the assembly should follow a different assembly pattern than that found in
humans at least for the attachment of these subunits to complex I. Indeed, the
carbonic anhydrase subunits of the module seem to be crucial for the beginning of
assembly of complex I in A. thaliana (Fromm et al. 2016). At that stage, our
knowledge is extremely limited since only two assembly factors have been demon-
strated to participate in complex I assembly in plants: IND1 (homolog of huInd1)
and L-galactono-1,4-lactone dehydrogenase (GLDH). The role of IND1 in complex I
assembly of A. thaliana is more complex than in humans as the factor has been
suggested to participate to both complex I assembly and mitochondrial translation
(Wydro et al. 2013). GLDH catalyzing the last step of ascorbate biosynthesis is
found in 400–850 kDa subcomplexes in A. thaliana and has been shown to be
necessary for the assembly of the membrane arm of the complex (Schimmeyer
et al. 2016). GLDH thus represents the first plant-specific assembly factor since
GLDH is not conserved in humans (Schimmeyer et al. 2016).
In C. reinhardtii, gamma carbonic anhydrase subunits are found by proteomic
analysis of complex I (Cardol et al. 2004). These subunits should also form a domain
like in Arabidopsis, as a gamma carbonic domain similar to that of Arabidopsis has
been found in Polytomella (Sunderhaus et al. 2006), a very close relative of
Chlamydomonas. This suggests that insertion of these subunits in the complex
should follow similar pattern to that proposed in plants. Ten out of the fourteen
assembly factors found in humans have putative homologs (Table 1), and the plant-
specific factor (GLDH) has also a homolog in C. reinhardtii (Table 1), but no
functional analysis has never been undertaken on these putative factors. Neverthe-
less, subcomplexes observed in mutants obtained in the core subunits allow us to
suggest a pattern for complex I assembly. Indeed, in nd5 or nd4 mutants and in a
mutant affected in the nucleus-encoded NUOB10 subunit (PDSW), a 700 kDa
subcomplex assembles and contains all modules except the Pd module, as proteomic
analysis suggested (Cardol et al. 2002, 2008; Barbieri et al. 2011). A 200 kDa soluble
subcomplex, bearing NADH dehydrogenase activity, is observed in wild-type, nd4
and nd5 mutants and is the only module detected in nd1, nd6, nd3, and nd4L mutants
(Cardol et al. 2002, 2006). It has been shown to contain at least the NUOS1 (75 kDa)
subunit (N module) and the NUO7 (ND7) subunit (Q module) (Cardol et al. 2002)
Table 1 Gene name of subunits and assembly factors of the mitochondrial OXPHOS chain
Saccharomyces Arabidopsis Chlamydomonas
Homo sapiens cerevisiae thaliana reinhardtii Reference
Complex I
Core subunits
NDUFS7 nuo19.3 j PSST NUO10 (PSST) a,f
NDUFS8 nuo21.3c j TYKY NUO8 (TYKY) a,f
NDUFV2 nuo24 j 24 kDa NUO5 (24 kDa) a,f
NDUFS1 nuo78 j 75 kDa NUOS1 (75 kDa) a,f
NDUFV1 Nuo51 j 51 kDa NUO6 (51 kDa) a,f
NDUFS2 nuo49 j Nad7 NUO7 (ND7) a,f
NDUFS3 nuo30.4 j Nad9 NUO9 (ND9) a,f
ND1 ndh-1 j Nad1 nd1 a,f
ND3 ndh-3 j Nad3 NUO3 (ND3) a,f
ND4L Mt-nd4l j Nad4L NUO11 (ND4L) a,f
Supernumerary subunits
NDUFA1 nuo9.8 j MWFE NUOA1 a,f
NDUFA2 nuo10.5 j B8 NUOB8 a,f
NDUFB3 nuo10.6 j B12 NUOB12 a,f
NDUFS6 nuo18.4 j 13 kDa NUOS6 a,f
NDUFA11 nuo21.3b j B14.7 TIM17 a,f
NDUFB11 nuo11.7 j NDU12 NUO17 a,f
NDUFS5 nuo11.5 j 15 kDa NUOS5 a,f
NDUFB4 nuo6.6 j NDU8 NUOB4 a,f
NDUFA12 nuo13.4 j DAP13 / B17.2 NUO13 a,f
NDUFA13 nuo14 j B16.6 NUOB16 a,f
NDUFB7 NCU11348 j B18 NUOB18 a,f
NDUFS4 nuo21 j 18 kDa NUOS4 a,f
NDUFA8 nuo20.8 j PGIV NUOA8 a,f
NDUFB9 NCU11258 j B22 NUOB22 a,f
NDUFB10 Nuo12.3 j PDSW NUOB10 a,f
NDUFA9 Nuo40 j 39 kDa NUOA9 a,f
NDUFB8 Nuo20.1 j ASHI TEF29 a,f
NDUFB2 NCU01436 j AGGG _ a,f
NDUFB1 Nuo20.9 j 20.9 kDa NUO21 a,f
NDUFC2 Nuo10.4 j NDU9 NUOP1 a,f
NDUFC1 NCU08300 j NDU10 Cre17.g725400 a,f
(continued)
68 S. Massoz et al.
Table 1 (continued)
NDUFA3 nuo9.5 j B9 Cre12.g537050 a,f
NDUFAB1 SDAP j _ ACP1 a,f
NDUFA7 NCU08930 j B14.5a Cre12.g484700 a,f
NDUFA4 NCU02016 j At3g29970 _ a,f
NDUFB5 nuo17.8 j SGDH _ a,f
NDUFA10 ATDNK DNK1 a,f
_ _ CA1 CAG1,CAG2, a,f
CAG3
_ _ CA2
_ _ CA3
_ _ CAL1
_ _ CAL2
_ _ P1 _ a,f
_ _ P2 _ a,f
_ _ _ NUOP4 a,f
_ _ _ NUOP5 a,f
_ _ At3g07480 NUOP3 a,f
Candidate plant- _
specific subunits
_ _ At1g68680 _ a,f
_ _ P3 _ a,f
_ _ TIM23–2 TIM23 a,f
_ _ At2g28430 _ a,f
_ _ DUF543 _ a,f
Assembly factors
NDUFAF1 CIA30 j At1g17350 NUOAF1 a,f
_ CIA84 j _ _ a
NUBPL IND1 k IND1 MNP1 a,f
Foxred1 _ At2g24580 Cre16.g671450 a,f
NDUFAF2 NCU00278 j At4g26965 _ a,f
NDUFAF3 _ At3g60150 Cre12.g496800 a,f
NDUFAF4 _ _ _ f
NDUFAF5 _ At1g22800 Cre13.g584750 f
NDUFAF6 NCU09517 j At1g62730 Cre03.g194300 f
NDUFAF7 _ At3g28700 Cre02.g096400 f
TIMMDC1 _ At1g20350 Cre10.g452650 f
TMEM126B _ _ _ f
Ecsit _ _ _ f
_ _ GLDH GLDH f,g
ACAD9 NCU06543 j IVD Cre06.g296400 f
AIF _ MDAR4 MDAR1 f
(continued)
Table 1 (continued)
Complex II
SDHA SDH1 SDH1–1, SDH1–2 SDH1 a
SDHB SDH2 SDH2–1, SDH2–2 SDH2 a
SDHC SDH3 SDH3–1 SDH3 a
SDHD SDH4 SDH4 SDH4 a
_ _ SDH5 _ a
_ _ SDH6 _ a
Assembly factors
SDHAF1 SDH6 At2g39725 LYR1 a,b
SDHAF2 SDH5 SDHAF2 Cre12.g550750 a,b
SDHAF3 SDH7 _ _ b
SDHAF4 SDH8 _ _ b
_ FLX1 _ Cre04.g217913 a
_ TCM62 _ _ a
Complex III
UQCRC1 COR1 COR1 QCR1 a
UQCRC2 QCR2 At3g16480, MPPA2 a
At1g51980
_ _ _ MPPA1 a
MT-CYB COB AtMg00220 cob a
CYC1 CYT1 At3g27240, CYC1 a
At5g40810
UQCRCFS1 ISP At5g13440, RIP1 a
At5g13430
UQCRQ QCR7 At4g32470, QCR7 a
At5g25450
UQCRB QCR8 At3g10860, QCR8 a
At5g05370
UQCRH QCR6 At2g01090, QCR6 a
At1g15120
UQCR10 QCR9 At3g52730 QCR9 a
UQCR10 QCR10 At2g40765 QCR10 a
UQCRFS1 _ _ _ a
Assembly factors
BCS1 BCS1 At5g17760 BCS1 a
ABC1 COQ8 At4g01660 COQ8 a
_ BCA1 _ _ a
UQCC1 CBP3 At5g51220 Cre01.g052050 a
UQCC3 CBP4 _ _ a,d
UQCC2 CBP6 _ _ a,c
TTC19 _ _ _ a
_ CYC2 _ _ a
(continued)
70 S. Massoz et al.
Table 1 (continued)
LYRM7 MZM1 _ Cre07.g332150 a
Cytochrome c
CYC CYC1 At1g22840, CYC a
At4g10040
Assembly factors
System III System III System I System III a
CCHL CYT2 _ HCS1 a
_ CYC2 _ a
_ CYC3 _ HCS2 a
_ _ _ HCS3 a
_ _ AtMg00830 _ a
_ _ AtMg00900 _ a
_ _ AtMg00960 _ a
_ _ AtMg00110 _ a
_ _ AtMg00180 _ a
_ _ At1g15220, _ a
At3g51790
Complex IV
MT-CO1 COX1 COX1 cox1 a
MT-CO2 COX2 COX2 COX2a a
_ _ _ COX2b a
MT-CO3 COX3 COX3 COX3 a
COX5b COX4 _ COX4/5b a
COX4I-1 COX5a _ _ a
COX4I-2 COX5b COX5B-1, COX5B- _ a
2
_ _ At3g62400, COX5C a
At2g47380, COX5C
COX5a COX6 _ _ a
COX7a COX7 _ _ a
COX7c COX8 _ _ a
COX6c COX9 _ _ a
COXVIIb _ _ _ a
COX8 _ _ _ a
COX6b COX12 COX6B-1, COX6B- COX12 a
3
COX6a COX13 COX6A COX13 a
_ _ _ COX90 a
Assembly factors
Membrane insertion and processing of complex IV subunits
OXA1L OXA1 OXA1 OXA1 a
COX20 COX20 _ _ a
(continued)
Table 1 (continued)
COX18 COX18 _ COX18 a
_ MSS2 _ _ a
_ MSS51 _ _ a
_ PNT1 _ _ a
_ IMP1 _ IMP1 a
IMMP2L IMP2 At3g08980 IMP2 a
_ SOM1 _ _ a
Copper metabolism and insertion into a
complex IV
COX17 COX17 COX17–2 COX17 a
SCO1, SCO2 SCO1, SCO2 HCC1, HCC2 SCO1 a
COX11 COX11 COX11 COX11 a
COX19 COX19 COX19–1 COX19 a
COX23 COX23 At1g02160 COX23 a
PET191 PET191 At1g10865 PET191 a
CMC1/CMC2 CMC1/CMC2 At2g07681, ccmC _ a
Heme A a
biosynthesis
FDX2 YAH1 MFDX1, MFDX2 MFDX a
ADR ARH1 _ ARH1 a
Assembly a
_ PET100 At4g14615, _ a
At1g52821
SURF1 SHY1 SURF1 SUR1 a
_ COX14 _ _ a
_ COA1/2/3 _ _ a
_ COX25 _ _ a
_ CMC3 _ _ a
_ COA4 _ _ a
CCDC90A FMP32 _ _ e
Unknown function a
COX16 COX16 At4g14145 COX16 a
CSRP2BP PET117 _ _ a
ATP synthase
Fo subcomplex
ATP6 ATPA ATP-1 ATP6 a
_ _ ATP6–2 _ a
ATP5F1 ATPB AtMg00640 _ a
ATP5G3 ATPC AtMg01080, ATP9A a
At2g07671
(continued)
72 S. Massoz et al.
Table 1 (continued)
_ _ _ ATP9B a
ATP5H ATPD At3g52300 _ a
ATP5I ATPE At5g15320 _ a
ATP5J2 ATPF At4g30010 _ a
ATP5L ATPG At2g19680 _ a
ATP5J ATPH _ _ a
ATP8 ATP8 AtMg00480 a
ATP5O ATP5 At5g13450 ATP5 a
ATPI INH1, STF1 At5g04750 _ a
_ STF2 _ _ a
_ ATPJ/I _ _ a
F1 subcomplex
ATP5A1 α AtMg01190, ATP1(α) a
At2g07698
ATP5B β At5g08670, ATP2 (β) a
At5g08680
At5g08690 a
ATP5C1 γ At2g33040 ATP3 (γ) a
ATP5D δ At5g47030 ATP16 (δ) a
ATP5E ε At1g51650 ATP15 (ε) a
_ ATPK _ _ a
_ _ At2g21870 _ a
_ _ _ ASA1 a
_ _ _ ASA2 a
_ _ _ ASA3 a
_ _ _ ASA4 a
_ _ _ ASA5 a
_ _ _ ASA6 a
_ _ _ ASA7 a
_ _ _ ASA8 a
_ _ _ ASA9 a
Assembly factors
Fo subcomplex
_ ATP10 AAF18252 _ a
ATP23 ATP23 _ _ a
_ ATP25 At3g03420.1 Cre17.g697934 a
OXA1L OXA1 OXA1 OXA1 a
_ ATP22 _ _ i
F1 subcomplex
ATPAF1 ATP11 At2g34050 ATP11 a
ATPAF2 ATP12 At5g40660 ATP12 a
_ FMC1 _ FMC1 a
(continued)
Table 1 (continued)
_ HSP90 _ HSP90 h
Alternative oxidase
_ AOX- AOX1a,AOX1b, AOX1 a
AAC37481 j AOX1c,AOX1d,
_ AOX2 AOX2
Type-II NAD(P)H dehydrogenase family
_ NDAe1, NDA1, NDA2 NDA1, NDA5 a
NDAe2, NDAi1
NDB, NDB2 NDA6, NDA7
NDB3, NDB4
NDC
Adapted from (a) Salinas et al. (2014), (b) Van Vranken et al. (2015), (c) Tucker et al. (2013),
(d) Brand et al. (2014), (e) Paupe et al. (2015), (f) Subrahmanian et al. (2016), (g) Klodmann and
Braun (2011), (h) Francis and Thorsness (2011), (i) Helfenbein et al. (2003)
j
Data retrieved from N. crassa
k
Data retrieved from Y. lipolytica
Gene names of complex I subunits of A. thaliana follow bovine nomenclature for the core and
supernumerary subunits. P1, P2, At3g07480 and gamma carbonic anhydrase (CA1, CA2, CA3,
CAL1, CAL2) do not have bovine counterparts but are not plant-specific either
and was postulated to be an early assembly intermediate (Subrahmanian et al. 2016).

Interestingly, recent studies showed that a NUO7-RNAi cell line still possesses the
200 kDa module (Massoz et al. 2014) despite the strong downregulation of the
NUO7 transcript and the absence of a whole complex I. In addition, the NUOS1
subunit (75 kDa subunit) was detected in the NUO7-RNAi cell line by immunoblot-
ting on membrane extracts, while the NUO8 (TYKY) and NUO10 (PSST) subunits
of the Q module were absent (Massoz et al. 2014). Thus, the question of the nature of
the 200 kDa module arises. Considering that both the N module and an early Q
module would have similar size (Fig. 2), they would co-migrate in BN-PAGE. We
thus propose that the subunit identification made in 2002 when we isolated the
subcomplex at 200 kDa was performed on both modules, which explains
the presence of NUO7 (Q module) and NUOS1 (75 kDa subunit) (N module) in
this previous analysis. This co-migration also explains that the NUO7-RNAi cell line
would still present the 200 kDa module (N module) while the Q module would be
absent. Together these results suggest that the Q and N module assembles
independently.
In conclusion, we suggest, three subcomplexes could be detected in Chlamydomonas
complex I mutants isolated so far: (1) a 700 kDa subcomplex still possessing
NADH dehydrogenase activity and barely attached to the membrane. A
subcomplex similar to the 700 kDa subcomplex has been identified in maize
deficient of ND4 (Karpova and Newton 1999), while in human cell lines,
ND4-deficient cell lines do not assemble the membrane components of complex
I (Hofhaus and Attardi 1993). (2) A 200 kDa module maintaining a NADH
74 S. Massoz et al.
dehydrogenase activity would correspond to the N module alone; such module

containing NDUFS1, NDUFV2, and NDUFV1 was reported to accumulate in
TIMMDC1-deficient knockdown cell lines in humans (Guarani et al. 2014); and
(3) a putative 200 kDa early intermediate corresponding to the Q module and
containing at least NUO7/NUO8/NUO9/NUO10. It could be similar to the
“subcomplex 3” observed in various organisms including humans during complex
I assembly (Vogel et al. 2007; Guarani et al. 2014). These elements are summa-
rized in Fig. 2.
In Chlamydomonas, complex I is a 950 kDa complex composed of up to 47 sub-
units (Subrahmanian et al. 2016). All core subunits are conserved, but the NUO3
(ND3) and NUO11 (ND4L) subunits are nucleus-encoded, as opposed to their
mammalian counterparts (Cardol et al. 2006). In addition to the 14 core subunits,
C. reinhardtii complex I is also composed of up to 33 supernumerary subunits (see
Table 1). Two subunits, NUOP4 and NUOP5, are specific to C. reinhardtii and
Volvox sp. (see https://phytozome.jgi.doe.gov/). The CAG1, CAG2, and CAG3 sub-
units are homologous to the gamma carbonic anhydrase (CA) subunits of A. thaliana
where two additional subunits (CAL1, CAL2) are also present (see above).
C. reinhardtii is attractive for studying complex I because algae deficient of that
complex survive due to the support of alternative NADH dehydrogenases (Lecler
et al. 2012) and photosynthesis. Many mutants have been identified, mostly
impaired in core mitochondrion- or nucleus-encoded subunits, and some of them
in supernumerary ones [reviewed in Salinas et al. (2014), Subrahmanian et al.
(2016)] including the NUOP4 subunit specific to C. reinhardtii (Massoz et al.
2015). Complex I mutants are generally screened based on their slow growth in
the dark phenotype. Indeed, their growth is significantly slower than wild type in
these conditions because they only retain two of the three phosphorylation sites that
are operational when electron transfer proceeds through the whole respiratory
chain. In contrast complex III and complex IV mutants do not grow in the dark
(see further) because they lack the cytochrome pathway and thus only retain one of
the proton-pumping enzymes of the respiratory chain. The less affected phenotype
of complex I mutants compared to complex III and complex IV mutants is also
observed in the light under mixotrophic conditions (light + acetate) for the same
reason (Remacle et al. 2001; Cardol et al. 2002; Massoz et al. 2014). As a
consequence, very little changes of their proteome are observed while a decreased
ROS production of about 30% is found (Massoz et al. 2014). Overall, this pheno-
type is much less severe than that observed in vascular plants like maize, tobacco,
and Arabidopsis thaliana, which are male sterile and/or display abnormal leaf
development [reviewed in Subrahmanian et al. (2016)].
2.2 Complex II
Complex II (1.3.5.1) catalyzes the reversible conversion of succinate into fumarate

and as such is also part of the Krebs cycle (Fig. 1):
succinate þ Q , fumarate þ QH2
It is a small multiprotein complex of about 110 kDa composed of four subunits

in most eukaryotes, including Chlamydomonas. The two matrix subunits, Sdh1 and
Sdh2, are anchored to the membrane by the Sdh3 and Sdh4 membrane subunits. The
Sdh1 subunit contains a flavin adenine dinucleotide (FAD) cofactor. The Sdh2
subunit is an iron-sulfur-containing protein bearing three Fe-S centers (2Fe-2S,
4Fe-4S, and 3Fe-4S). Sdh3 and Sdh4 harbor two ubiquinone reduction sites and a b-
type heme at the interface of both subunits. Only the high-affinity ubiquinone
reduction site (Qp) is used during electron transport, and the crystal structure of
complex II has shown that the Qp is formed by Sdh3 and Sdh4 but also part of the
Sdh2 domain (Sun et al. 2005). The role of both the b-type heme and low-affinity
ubiquinone reduction (Qd) sites remains unclear. Yeasts deprived of their b-type
heme are still able to assemble a functional complex II (Oyedotun et al. 2007).
Unlike complexes I, III, or IV, complex II does not contribute to the formation of
the proton gradient. The succinate oxidation into fumarate has been described to
function as a two-state “free-occupied mechanism” (Cheng et al. 2015) where the
reaction would go as follows: Binding of succinate to complex II induces confor-
mational changes of the enzyme from free to occupied. During occupied confor-
mation, the FAD cofactor is reduced. The occupied conformation becomes unstable
once the FAD is reduced into FADH, and the conformational equilibrium is
shifted toward free again, where fumarate binding is unfavorable and thus released.
The electron can then be transferred to the nearest Fe-S cluster (2Fe-2S) and then to
the 4Fe-4S and 3Fe-4S centers, and the cycle is repeated.
In OXPHOS complexes, the most hydrophobic subunits are encoded in the
mitochondrial genome, while most hydrophilic subunits are encoded in the nuclear
genome. In contrast, all four subunits, including the membrane-anchored Sdh3 and
Sdh4, are usually encoded in the nuclear genome except in primitive mitochondrial
genomes such as the one of Reclinomonas americana where Sdh3 is found (Lang
et al. 1997). The exact mechanism for the assembly of complex II has yet to be fully
comprehended, but clues have been given by studies on yeast. We currently know
six assembly factors involved in complex II biogenesis [reviewed in Rutter et al.
(2010), and Van Vranken et al. (2015)]. It is accepted that Sdh1 and Sdh2 matrix
proteins dimerize prior to the assembly with Sdh4 and Sdh3 membrane proteins.
The first step of the assembly process is the maturation of the Sdh1 and Sdh2
subunits. The insertion of the FAD cofactor to Sdh1 requires Flx1, a protein
involved in maintaining the mitochondrial matrix balance in flavin nucleotide
(Tzagoloff et al. 1996). The flavinylation of FAD requires Sdh5, a mitochondrial
assembly factor (Hao et al. 2009), which is only found associated with Sdh1, when
the latter is not dimerized with Sdh2. Sdh5 is likely to interact with Sdh1 but not
directly with the FAD group. Interestingly, loss of Sdh5 does not lead to complete
impairment of complex II (Van Vranken et al. 2015; Eletsky et al. 2012). During
this stage, the Sdh8 assembly factor has been shown to be associated with Sdh1
76 S. Massoz et al.
until dimerization occurs. Its role has been speculated to protect FAD and to
maintain Sdh1 in an assembly-competent state (Van Vranken et al. 2015).
Regarding Sdh2 maturation, incorporation of the Fe-S clusters is needed prior to
dimerization. This step involves at least two assembly factors named Sdh6 and
Sdh7. Despite the fact that both proteins possess a LYR motif, recently identified as
interacting with Fe-S centers in mammals (Rouault 2015), no direct evidence
currently points at those proteins as actually playing a role in Fe-S cluster transfer
into the Sdh2 subunits. These two assembly factors are thought to protect the Sdh2
subunits and the Sdh1/Sdh2 dimers before assembly with Sdh3 and Sdh4 (Un et al.
2014). Little is known about the Sdh3 and Sdh4 subunits assembly process, beside
the fact that Sdh1 and Sdh2 seem to be needed for Sdh3 and Sdh4 to assemble. At
last, a protein named Tcm62 has been shown to play a role in complex II assembly.
A mutant isolated in yeast was shown to be depleted in complex II activity (Dibrov
et al. 1999). The exact role of Tcm62 is still under discussion, but it has been
suggested to support protein folding, most likely primarily Sdh2 (Rutter et al. 2010;
Dibrov et al. 1999).
In C. reinhardtii three out of these six assembly factors have been predicted
based on genome analysis (Table 1), but little is known about eventual similar-
ities or differences in the assembly steps. To our knowledge, no complex II
mutants have been characterized so far, but a mutant potentially affected of
Sdh3 has been identified in the indexed mutant library recently produced
(Li et al. 2016). It is interesting to note that even though C. reinhardtii is part
of the green lineage, its complex II doesn’t share the complexity of complex II in
land plants which is composed of eight subunits (Salinas et al. 2014).
2.3 Complex III
Complex III (EC 1.10.2.2), the third complex of the OXPHOS chain and the second
proton-pumping complex, catalyzes the following reaction:
2QH2 þ2 ferricytochrome cþ2Hþ Matrix ) QH2 þ2ferrocytochrome cþ4Hþ IMS
It functions as a multiprotein homodimeric structure of approximately 490 kDa,

each monomer containing ten to eleven subunits in yeast and mammals. Among
these, the three core subunits are homologs to the three subunits of prokaryotic
complex III (Trumpower 1990b): cytochrome b (COB), cytochrome c1 (CYC1),
and Rieske iron-sulfur protein (ISP), while eight subunits are supernumerary sub-
units. Cytochrome b contains the ubiquinone oxidation site (Qo) and ubiquinone
reduction site (Qi) separated by two b-type hemes. One heme (bL) is close to the Qo
site and has a low redox potential, and the other heme (bH) has a high potential
heme (Wenz et al. 2009). The Rieske protein contains a 2Fe-2S center allowing
transfer from cytochrome b to cytochrome c1. Cytochrome c1 contains a
c-type heme.
Complex III participates to proton gradient formation through the Q cycle

(Trumpower 1990a). In short, upon oxidation of ubiquinol at the Qo site (on the
IMS side), two protons are released into the IMS while two electrons are transferred
through complex III. The first electron will be transferred successively to iron-sulfur
Rieske protein, to cytochrome c1, and then to soluble cytochrome c. The second
electron will be transferred on the bL heme and then on the bH heme. This electron
will then reduce a ubiquinone into a semiquinone at the Qi site on the matrix side.
The newly oxidized ubiquinone will then leave the Qo site, and the cycle is repeated
when a second ubiquinol enters and gets oxidized, leading to a second electron being
transferred to cytochrome c and the semiquinone to be fully reduced into ubiquinol
on the Qi site by the second electron. In terms of protons, the result of this four-
electron transfer is four protons being ejected into the IMS and two protons from the
matrix being used to reduce a ubiquinone on the Qi site. The key to the Q cycle is
the correct routing of both electrons to either the Rieske protein or the bL heme. The
flexibility of the Rieske protein and its dual conformation in oxidizing and reducing
competent positions (Zhang et al. 1998) seem to be one of the main elements for the
Q cycle. Recently, the so-called surface-affinity-modulated ISP-ED (extrinsic
domain of iron-sulfur protein) motion switch hypothesis (Xia et al. 2013) proposes
that the binding of a ubiquinol into the Qo site will trigger conformational changes,
maybe due to the widening of Qo to accept the substrate. This would transmit a
signal to an alpha-helix around Qo to switch into “on” position, increasing the
affinity of the Rieske protein for cytochrome b. This will lock the Rieske protein
in a position where it can receive an electron from cytochrome b but cannot give it to
cytochrome c1, now too far away. The Rieske protein is locked in docking position
with cytochrome b until ubiquinone has been released. This will force the second
electron to go through bL. Once both electrons are transferred and the ubiquinone
released, the Rieske protein is freed from its interactions with cytochrome b,
allowing it to move to a closer position to cytochrome c1 and transfer its electron.
It has been proposed that the reduction events in both Rieske and bL happen
simultaneously (Zhu et al. 2007).
In complex III, only the COB subunit is synthesized inside the mitochondrion:
all other proteins are imported from the cytosol. Currently, our knowledge about
complex III assembly is scarce. Indeed, only a limited number of assembly factors
have been described from the investigation in yeast. Accordingly, the yeast nomen-
clature will be used for the following description.
COB is known to be the first protein in the assembly process. Cpb6 and Cpb3
assembly factors are known to be part of the COB assembly process. These proteins
have been proposed to interact early in the assembly process directly with the
ribosome and to be needed for efficient translation (Gruschke et al. 2011); these two
assembly factors are also important for complex III maturation since they are found
on early subcomplex intermediates (Gruschke et al. 2012). The Cpb4p assembly
factor has also been shown to be part of an early COB subcomplex, though it does
not interact with the Cpb3 and Cbp6 assembly factors (Brand et al. 2014). During
this first stage of assembly, Qcr7 and Qcr8 supernumerary subunits are added to the
newly synthetized COB subunit. Qcr7 and Qcr8 seem important for the progress of
78 S. Massoz et al.
assembly, since the deletion of the corresponding genes prevent further

subcomplexes to be produced (Zara et al. 2007). The next step is the assembly of
the core protein 1 (encoded by COR1) and core protein 2 (encoded by QCR2)
subunits and cytochrome c1. There is currently no data on how these subunits are
assembled, but because their absence prevents the assembly of later subcomplexes,
they might be incorporated simultaneously (Zara et al. 2007). It has also been
shown that these subunits are able to interact together and form small complexes if
the initial COB subcomplex is not present. The incorporation of core proteins 1 and
2 triggers the release of the Cpb4 assembly factor (Gruschke et al. 2012). This stage
of assembly is referred to as the late core assembly stage. In addition to the core
proteins 1 and 2 and cytochrome c1 subunits, this intermediary subcomplex also
contains the Qcr6 and Qcr9 supernumerary subunits and an additional assembly
factor called Bcs1. Bcs1 is an AAA ATPase needed for the latter insertion of ISP
(Rieske) protein (Conte et al. 2015). The Bca1 assembly factor has also been shown
to play a role in the formation of the late core assembly stage though its exact role is
still unknown (Mathieu et al. 2011). At this stage, complex III has been shown to
already be in its dimeric conformation (Conte et al. 2015). The last stage of
assembly consists in the addition of the ISP (Rieske) protein and the Qcr10 subunits
and requires the Bcs1p and Mmz1p assembly factors. Qcr9, along with Mzm1, has
been shown to be able to interact specifically with ISP in yeast and in strains where
early assembly intermediates are stalled (Phillips et al. 1993; Smith et al. 2012).
The Mzm1p possesses a LYR motif that might interact with the Fe-S center of ISP
(Smith et al. 2012). The Coq8 protein has been predicted to be a chaperone for
complex III (Brasseur et al. 1997) and was also linked to coenzyme Q synthesis
pathways (Do et al. 2001). Its role in complex III assembly has thus been proposed
to be related to quinone availability. Though only known to be present in meta-
zoans, TTC19, an inner membrane protein possessing a tetratricopeptide motif, has
been shown to be involved in complex III assembly (Ghezzi et al. 2011), possibly as
a chaperone. In C. reinhardtii, only four assembly factors have been identified so
far in the genomic sequence (Table 1).
Cytochromes c are redox-active proteins containing a c-type heme covalently
bound by two cysteine residues. In mitochondria, cytochromes c are represented by
cytochrome c1 in complex III and soluble cytochrome c. Various assembly mech-
anisms have been identified and described for cytochromes c (Mavridou et al. 2013;
Allen et al. 2008). In mitochondria, system III is used to import and mature
cytochrome c, while cytochrome c1 is imported differently through the TIM/TOM
machineries (Mavridou et al. 2013). System III requires the intervention of a unique
enzyme for the cytochrome c maturation, the cytochrome c heme lyase, or the
cytochrome c1 heme lyase. In yeast, Cyt2 has been shown to be a cytochrome c1
heme lyase (Zollner et al. 1992), and Cyc3 have been shown to be a cytochrome
c heme lyase (Dumont et al. 1987), though the latter was shown to also be active on
cytochrome c1 (Bernard et al. 2003). In C. reinhardtii, cytochrome c and cyto-
chrome c1 lyases are also present (Bernard et al. 2003). Humans only possess one
gene with both functions (Prakash et al. 2002). In yeast, Cyc2 is also involved in
cytochrome c/c1 maturation. Cyc2 was proposed to regulate Cyc3 activity and
participate in heme attachment. It seems to be essential when Cyt2 is inactive

(Bernard et al. 2003; Smith et al. 2012). No Cyc2 homolog was found in
C. reinhardtii (Salinas et al. 2014).
Complex III in C. reinhardtii probably possesses eleven subunits (Table 1).
Among them, ten are conserved between C. reinhardtii, humans, and A. thaliana,
MPPA1 being the only protein specific to C. reinhardtii. Core protein 1 and core
protein 2 from higher plants possess a proteolytic activity (mitochondrial
processing peptidase or MPP) that cleaves the transit peptide of preproteins when
they are imported into mitochondria (Glaser and Dessi 1999). In Chlamydomonas,
QCR1 (homolog of core 1 protein) exhibits consensus sequences typical of β-MPP
protein, while MPPA2 (homolog of core 2 protein) does not share consensus
sequences for α-MPP activity (van Lis et al. 2003). Nevertheless, a third compo-
nent, with the characteristics of an MPP α-subunit (MPPA1), is also encoded in
Chlamydomonas (Cardol et al. 2009a). The question of the in vivo mitochondrial
processing activity of complex III in C. reinhardtii remains thus open.
In C. reinhardtii, only cob mutants have ever been produced (listed in Salinas
et al. 2014), resulting in a lack of complex III activity and assembly due to the
central position of cytochrome b subunit. Chlamydomonas complex III mutants
lack the whole cytochrome pathway of respiration due to the colinearity of both
complexes III and IV. The resulting lack of ATP caused by the loss of the two
proton-pumping enzymes leads to the inability of such mutants to grow under
heterotrophic condition (acetate + dark) (Salinas et al. 2014). This inability to
grow in the dark is the main screening method currently used to obtain complex
III mutants. Mutants can also be identified using a TTC (triphenyltetrazolium
chloride) reducing test (Dorthu et al. 1992). In C. reinhardtii, complex III deficien-
cies have been shown to be impactful enough to disturb photosynthesis (Cardol
et al. 2003). When coupled with a stt7 mutation, leading to the lack of flexibility in
energy redistribution between photosystems, complex III mutants display a drop in
photosynthetic efficiency when measured both in the dark and the light. This
phenotype allows easy identification of complex III mutants using fluorescence
measurements (Cardol et al. 2009b; Massoz et al. 2015).
2.4 Complex IV
Complex IV (1.9.3.1) is the last proton-pumping complex of the OXPHOS chain

with a size of approximately 200 kDa. It catalyzes the reaction:
4 ferrocytochrome c þ O2 þ 8Hþ matrix ! 4 ferricytochrome c þ 2H2 O þ 4Hþ IMS
The Cox1, Cox2, and Cox3 subunits are the core subunits of complex IV. The
Cox1 subunit bears heme a, heme a3, and the CuB center. The Cox2 subunit carries
the CuA center, while the Cox3 subunit does not bear any prosthetic groups. In most
organisms, Cox1, Cox2, and Cox3 are encoded in the mitochondrial genome as they
80 S. Massoz et al.
are membrane-embedded subunits. In addition, around seven to eleven supernu-

merary subunits have been identified in mammals, yeasts, or plants [reviewed in
Salinas et al. (2014)].
In complex IV, four electrons are transported onto molecular oxygen to produce
two water molecules, while four protons are transferred into the IMS. Two proton-
transfer channels have been identified in the Cox1 protein. They are called D and K
channels, based on the presence of conserved Asp (D) and Lys (K) residues at the
beginning of each channel, respectively. The D channel is filled with a series of
ordered water molecules forming a proton-conductive pathway and helping to reach
a conserved Glu residue at its end. Electrons are transferred from soluble cyto-
chrome c through CuA and heme a toward the binuclear center (CuB and heme a3;
BNC). The proton-transfer mechanisms contain several steps involving the BNC
and are reviewed in Kaila et al. (2010). In short, the ligation of the molecular
oxygen to the BNC leads to a split of the molecule. Following that event, four
cycles of one-electron reduction step occur, accompanied by the pumping of two
protons each time: one into the proton-loading site (PLS) and one into the BNC for
chemistry. Though the four cycles have identical chemical balance, they all possess
different kinetics. The proton pumped into the PLS is transferred into the IMS by a
still unknown mechanism. It has been shown that the K channel only participates in
one (maybe two) proton transfer(s) (Wikstr€om et al. 2000; Svensson-Ek et al.
2002). Notably, during the reductive phase when the heme a3 might be already
bound to a water molecule, (the) proton(s) would be pumped through the K channel
which is the closest to the CuB center. This would lead the D channel to effectively
pump the four protons leading to the PLS and at least two of the protons leading to
the BNC. From this perspective, one can ask how protons from the same channel
can be routed toward PLS or BNC. Water wire pathways would form leading
preferentially toward one site or another (Wikstr€ om et al. 2000). This water gate
phenomenon has been shown to be dependent on the redox state of the two hemes of
the enzyme and helps redirect proton toward the right site. The Cox3 subunit is a
major subunit of complex III, but it does not carry any redox component. It has been
shown that a mutant in COIII (Cox3 homolog) of Paracoccus denitrificans might
assemble a COI and COII (Cox1 and Cox2 homolog) subcomplex, though not
properly functional (Haltia et al. 1989). Studies showed that Cox3 was important
for maintaining the correct function of the D channel (Hosler 2004). The Cox3 area
surrounding the conserved Asp in the D channel has been proposed to raise the
proton affinity for this conserved amino acid to trap protons. In addition, COXIII
has been shown to stabilize a hydrocarbon chain in close proximity to the water
chain inside the D channel, potentially helping them to maintain a correct arrange-
ment inside the channel. COXIII also plays a key role in maintaining the exit proton
pathway.
Complex IV biogenesis is by far the most understood assembly process among
OXPHOS complexes in yeast with more than 30 assembly factors identified so far,
with various functions from RNA stabilization to heme maturation. Unfortunately,
most of these identified proteins have no equivalents in Chlamydomonas (Table 1).
It is accepted that the three Cox subunits assemble and mature independently of each
other before being assembled together. This process is reviewed in Soto et al. (2012).
The Cox1 subunit is the first to be inserted in the membrane, a process which requires
at least the conserved Oxa1 protein. Cox2 is then inserted and processed in the
membrane, thanks to at least Oxa1 in addition to the Cox20 and Cox18 assembly
factors. The two proteins will then be attached to each other. The Cox3 subunit will
then be assembled and attached to the Cox1 and Cox2 subcomplex. Unlike the Cox
assembly process, the heme insertion and maturation assembly seem much more
conserved between yeast and Chlamydomonas. The current knowledge is reviewed
in Barrientos et al. (2009) and Soto et al. (2012). The copper cofactor maturation
pathway involved the Cox17, Cox19, and Cox23 assembly factors; these three
soluble proteins possess copper-binding motifs and are thought to be part of a copper
distribution pathway. The Cox17 assembly factor would also transfer copper to Sco1
and Cox11, two membrane chaperones proposed to facilitate copper insertion into
the Cox1 and Cox2 subunits. Cox17 mutants have been produced in
Chlamydomonas (Remacle et al. 2010). In cox17 mutants, total amount of complex
IV was found unchanged, but complex IV activity was decreased, an observation
that was explained by a diminished copper availability. Inside complex IV, hemes
a are present. These hemes are derived from heme b transformed into heme O and
then finally into heme a. The conversion from heme b to heme O is processed by at
least Cox10, while the conversion from heme O to heme a is processed through two
discrete monooxygenase steps. The first step is catalyzed by at least Cox15, Mfdx
(Yah1 in yeast) (Barros et al. 2001), and Arh1 (Soto et al. 2012). No enzyme has been
yet identified as candidate for the subsequent oxidation step (Soto et al. 2012).
Interestingly, a C. reinhardtii mutant (called w17) was recently identified in a
hydroxylase/monooxygenase with a partial dark growth defect phenotype (Massoz
et al. 2015). It was later shown that this mutant possessed a 30% reduced complex IV
activity (Massoz, unpublished data), though a clear relationship between the
depleted gene and the actual phenotype remains to be demonstrated.
In C. reinhardtii, ten subunits have been confirmed to compose complex IV, and
eight potential subunits homologous to those found in other eukaryotes were found
in the genome (Cardol et al. 2005; van Lis et al. 2003) including the subunit COX90
specific to Chlamydomonas (Lown et al. 2001). COX2 and COX3 are encoded in
the nucleus in C. reinhardtii (Perez-Martinez et al. 2001, 2002). In addition, the
COX2 gene is split into COX2a and COX2b genes, a characteristic shared by all
chlorophycean algae (Rodriguez-Salinas et al. 2012). Both COX3 and COX2a/b
have gained attributes from nuclear genomes, proper codon usage and introns, and
an overall decreased hydrophobicity in the corresponding gene products compared
to their mitochondria-encoded counterparts (Perez-Martinez et al. 2001).
Complex IV nuclear mutant (cox3 mutant) or mitochondrial mutant (cox1
mutant) in C. reinhardtii shows no complex IV activity or assembly altogether
(Colin et al. 1995; Remacle et al. 2010) and, like complex III mutants, lack the
whole cytochrome pathway of respiration.
82 S. Massoz et al.
2.5 ATP Synthase
Mitochondrial F1Fo-ATP synthase (EC 3.6.1.3) has a pivotal role in OXPHOS by

catalyzing the reaction ADP + Pi + nH+IMS <¼> ATP + nH+Matrix. The complex is
present in the inner mitochondrial membrane and forms oligomers that are
believed to determine the morphology of the yeast mitochondrial cristae (Paumard
et al. 2002). Although exhibiting some differences, the well-characterized yeast
and the beef heart enzymes share a similar subunit composition. The enzyme
works as a molecular motor (Oster and Wang 2003) with a central rotary axis
[formed by subunits γ/δ/ε/c-ring] and several fixed elements that include the
catalytic core (subunits α3/β3), a peripheral stalk (OSCP/b/d/F6), a dimerization
module (A6L/e/f/g), and other fixed elements (subunit a) (Arselin et al. 2004;
Walker and Dickson 2006). Proton passage through both subunit a and the c-ring
induces the rotation of the γ/δ/ε central stalk (Wächter et al. 2011). The rotation of
subunit γ impels the three catalytic β-subunits to form ATP from ADP + Pi
(Yasuda et al. 1998). The peripheral stalk impedes rotation of the α3/β3 moiety
while counteracting the torque generated by the rotation of the γ-subunit (Dickson
et al. 2006). Regulatory polypeptides, such as the inhibitory protein IF1, prevent
the enzyme from hydrolyzing ATP (Gledhill and Walker 2005).
The mitochondrial ATP synthase of chlorophycean algae has diverged substan-
tially from the yeast and bovine enzymes and exhibits salient differences in terms of
subunit composition and structural features. For example, both the C. reinhardtii β-
and α-subunits exhibit atypical sequence extensions of 70 residues in the C-terminus
and of 18 residues in the N-terminus, respectively (Franzén and Falk 1992;
Nurani and Franzén 1996). Much has been learned on the structure and function of
the mitochondrial ATP synthase from algae by studying the enzyme from
Polytomella sp., a colorless, close relative of Chlamydomonas that lacks chloro-
plasts and a cell wall (Figueroa-Martinez et al. 2015). Lauryl maltoside-solubilized
mitochondrial F1Fo-ATP synthases of C. reinhardtii and Polytomella sp. migrate in
blue-native electrophoresis as a 1600 kDa dimer (van Lis et al. 2003; Villavicencio-
Queijeiro et al. 2009). When the C. reinhardtii genome became known (Merchant
et al. 2007), the components of the enzyme whose N-terminal sequences had been
previously obtained by Edman degradation (Funes et al. 2002) were identified. Thus,
the enzyme was found to be constituted by the classical subunits α, β, γ, δ, a (ATP6),
c (ATP9), and OSCP, while no homologs of the ε, b, d, e, f, g, IF1, A6L, and F6
subunits could be found encoded in the algal genome. In addition, the enzyme
contained polypeptides with no known counterparts in the databases, and these
were named Asa1 to Asa9, for “ATP synthase associated components” (Fig. 3).
The polypeptide composition of the mitochondrial ATP synthase of Polytomella
sp. was found to be similar to the one of C. reinhardtii enzyme (Vazquez-Acevedo
et al. 2006; van Lis et al. 2007). Although the biochemical characterization of the
mitochondrial ATP synthase has been carried out mainly with C. reinhardtii and
Polytomella sp., genes encoding homologs of Asa subunits are found in other
chlorophycean algae including members of the genera Chlamydomonas,
Fig. 3 Subunit composition and localization of Chlamydomonas mitochondrial ATP synthase
Chloroccocum, Dunaliella, Polytomella, Scenedesmus, and Volvox (Lapaille et al.

2010; Colina-Tenorio et al. 2015). The idea that these unique proteins could be the
main constituents of the peripheral stalk of the complex and the elements responsible
of the enzyme’s dimeric nature was formulated (Lapaille et al. 2010; Colina-Tenorio
et al. 2015). All the subunits that form the mitochondrial ATP synthase of
chlorophycean algae seem to be nucleus-encoded; to date, no genes encoding a
subunit of the enzyme has been identified in the corresponding algal mitochondrial
genomes (Vahrenholz et al. 1993; Smith and Lee 2009; Smith et al. 2010; Hamaji
et al. 2013), not even the three mitochondrial genes frequently present in mtDNA:
atp6, atp8, and atp9.
The isolated mitochondrial ATPases from the green alga C. reinhardtii exhibited
a specific activity of 2.9 U/mg with only 40% sensitivity to oligomycin (Nurani and
Franzén 1996), an antibiotic that usually fully inhibits the enzyme. The Polytomella
sp. enzyme showed a very low ATPase activity that markedly increased up to 3.8 U/
mg when nonionic detergents are present in the activity assay. The hydrolytic
activity is sensitive to the classical inhibitors oligomycin and DCCD
(Villavicencio-Queijeiro et al. 2015), although oligomycin seems to bind loosely.
Indeed, while oligomycin readily inhibits algal growth, respiration, and ATP levels
in several classes of chlorophytes, chlorophycean algae seem not to be affected
(Lapaille et al. 2010).
Neighboring interactions of Asa subunits in the ATP synthase of Polytomella
sp. have been studied by silencing the expression of Asa subunits, generating
subcomplexes by partial dissociation of complex V, reconstituting subcomplexes
using recombinant subunits in vitro, cross-linking the purified enzyme, and modeling
the complex by EM image reconstruction. Knockdown experiments using RNA
84 S. Massoz et al.
interference abolished expression of the Asa7 subunit in C. reinhardtii. Although

neither growth nor OXPHOS of the alga was affected, the intact enzyme could not
be isolated, since it dissociated upon lauryl maltoside solubilization (Lapaille et al.
2010). Therefore, Asa7 was proposed to play a pivotal role in maintaining the stability
of the peripheral stalk. Asa1 is thought to be the main support of the peripheral stalk,
playing a structural role analogous to subunit b in orthodox enzymes (Colina-Tenorio
et al. 2015), probably making a bridge between the OSCP subunit and other poly-
peptides that may be embedded in or closer to the membrane (Asa3, Asa5, Asa8, a and
c10-ring). Subunits Asa2, Asa4, and Asa7 interact to form an Asa2/Asa4/Asa7
subcomplex that establishes contacts with Asa1 and with OSCP (Miranda-Astudillo
et al. 2014); thus, the peripheral stalk seems to be formed by the intertwining of several
polypeptides, including Asa1, Asa2, Asa4, and Asa7. In contrast, the smaller subunits
Asa6, Asa8, and Asa9 are predicted to have transmembrane stretches and to form the
dimerization domain of the algal mitochondrial ATP synthase. An updated model for
the topological disposition of the 17 polypeptides that constitute the algal enzyme has
been proposed recently (Vázquez-Acevedo et al. 2016) and is shown in Fig. 3.
The dimeric algal ATP synthase has been observed in several electron micros-
copy studies including 3D tomography (Dudkina et al. 2005, 2010; Cano-Estrada
et al. 2010). The ATP synthase oligomers seem to make helical arrangements along
the cristae membranes, confirming the role of complex V in determining the shape
of the inner mitochondrial membrane (Dudkina et al. 2006). An electron cryo-
microscopy map of the Polytomella sp. dimeric ATP synthase at 6.2 Å resolution
(Allegretti et al. 2015) has revealed some finer architectural details (Fig. 3). A
salient feature is that the peripheral stalks are very robust and constituted by alpha-
helices that seem to form coil-coiled structures that contact the F1 sector more than
once. The overall dimeric structure is further reinforced by protein-protein contacts
that unite the two peripheral stalks in their middle region. Subunit a was found to
contain four alpha-helices that are embedded in the bilayer almost horizontally,
partially surrounding the c-ring. A high-resolution structure of the algal mitochon-
drial ATP synthase is still needed in order to learn about the detailed topology of all
its components.
Although some studies have addressed the biogenesis of the CF1-CFo chloroplast
ATP synthase of Chlamydomonas (Drapier et al. 2007), almost nothing is known about
the assembly of its mitochondrial counterpart. Nevertheless, the mitochondrial enzyme
is expected to follow the almost universal three-module process that has been described
for the F1Fo-ATPases of bacteria, chloroplasts, and mitochondria (Rühle and Leister
2015). The biogenesis of the mitochondrial system has been studied in depth in yeast,
where complex V assembles in distinct independent modules (Rak et al. 2011): (1) the
soluble F1 module comprising subunits α3/β3/γ/δ/ε, (2) the c10-ring of the Fo sector, and
(3) a stator module comprising subunits a/b/d/h/8. In consecutive steps, the F1 module
associates to the membrane-bound c10-ring forming a α3/β3/γ/δ/ε/c10 subcomplex and
subsequently to subunit a of the stator module, giving rise to a α3/β3/γ/δ/ε/c10/a/b/d/h/
8 subcomplex. The possibility of futile proton efflux in early stages of the assembly of
such a complex enzyme driven by the chemiosmotic potential is avoided by the late
addition of the c10-ring to the proton-translocating subunit a. The whole complex is
then completely stabilized by the further incorporation of the membrane-bound subunit

f and of the OSCP subunit, the latter one binding to the peripheral stalk and to the α3/β3
catalytic core, therefore fixing together all the stator components of the ATP synthase.
Dimerization of the enzyme must occur upon the incorporation of the membrane-
bound subunits e and g. One can only speculate that the C. reinhardtii complex V will
follow a similar biogenesis pathway with a three-module assembly process; neverthe-
less, it is clear that it will exhibit some distinct features, since the highly robust
peripheral arm and the dimerization sector must be assembled through sequential
incorporation of all the atypical Asa subunits found only in chlorophycean algae.
The complex assembly of the mitochondrial F1Fo-ATP synthase is assisted at all
stages by several chaperones and assembly factors. The biogenesis of the soluble F1
module (subunits α3/β3/γ/δ/ε) is facilitated by the matrix-localized chaperones
Fmc1p, Hsp90, Atp11p, and Atp12p (Lefebvre-Legendre et al. 2001; Wang et al.
2001; Francis and Thorsness 2011). Homologs of all these four proteins are present
in C. reinhardtii (see Table 1). In addition, other players in the formation of the Fo
sector have also been identified in the green alga: Atp25 that participates in the
expression and oligomerization of subunit c (Zeng et al. 2008) and Oxa1 that plays
a role in the association of the c-ring with subunit a (Jia et al. 2007). In contrast,
other assembly factors previously characterized in the yeast system including
Atp22 (that promotes synthesis of subunit a), Atp23 (that is involved in the
maturation of subunit a), and Atp10 (that promotes the association of subunit
a with subunit 8) seem not to be present in the green alga.
3 Alternative Pathways
In addition to the four main complexes, alternative type-II NAD(P)H dehydroge-

nases can transfer electrons from NADH to ubiquinone and alternative oxidase
(AOX) from ubiquinone to molecular oxygen (Fig. 1). These alternative enzymes
do not participate in the formation of a proton gradient. Mitochondrial type-II NAD
(P)H dehydrogenases located on the surface of the mitochondrial inner membrane
face either the intermembrane space or the matrix. They are monomeric enzymes of
40–60 kDa contrary to the multimeric type-I NADH dehydrogenases (complex I)
and usually contain one non-covalently bound FAD as prosthetic group (Møller
et al. 1993). Alternative oxidases are homodimeric, and the monomeric unit has a
size of about 40 kDa. They contain a covalently bound diiron center that catalyzes
the four-electron reduction of dioxygen to water by ubiquinol (Siedow et al. 1995;
Shiba et al. 2013). The presence of these two types of enzymes allows for better
survival of C. reinhardtii mutants affected in complex I, III, or IV and partly
explains why isolating mutants deficient of OXPHOS complexes in C. reinhardtii
is possible.
In C. reinhardtii, alternative oxidase is encoded by two genes: AOX1 and AOX2
(Dinant et al. 2001), with AOX1 being the most abundant transcript. Multiple roles
are assigned to alternative oxidase. First it serves as security valve preventing
86 S. Massoz et al.
over-reduction of the ubiquinone pool and thus acting as against ROS accumulation
(Milani et al. 2001) and allowing a better functioning for complex III, since
ubiquinone is required in the Q cycle. Second, the AOX pathway, serving as a
modular exit point for electrons, would allow a more constant reoxidation of
NADH, which is used as electron acceptor upstream of the OXPHOS. Such
functions are reflected in Chlamydomonas AOX-RNAi cell lines (Mathy et al.
2010), where ROS production is increased up to fivefold and the ROS scavenging
enzymes are overexpressed. The mutant cell lines also exhibit heavy metabolic
changes (Mathy et al. 2010) with an overall decrease in the catabolic pathways such
as glycolysis, Krebs cycle, and glyoxylate cycle and a shift toward anabolic
pathways. These metabolic changes lead to increased cell size and biomass without
any impact on growth rate. In complex III mutants or WT strain exposed to H2O2,
AOX1 transcripts exhibit increased expression (Dinant et al. 2001) correlated to an
increased amount of proteins (Molen et al. 2006).
AOX has also been shown to be induced in Chlamydomonas by a variety of
stresses including cold, ROS exposure, change in the source of nitrogen source
(Molen et al. 2006), or heat (Zalutskaya et al. 2015). All these external conditions
are likely to activate several specific transcription factors, since a reporter gene built
with a 1073 bp fragment of the AOX1 promoter would not respond to all stresses
(Molen et al. 2006). Posttranscriptional regulations are also involved since the
complex III inhibitor antimycin A leads to an increase at the transcript level but
not at the protein level (Molen et al. 2006).
Alternative NADH dehydrogenase transfers electrons from NADH to the ubi-
quinone pool. Among the six type-II NADH dehydrogenases identified in
Chlamydomonas (Cardol et al. 2005), the 53 kDa NDA1 has been shown to be
localized at the inner side of the mitochondrial membrane (Lecler et al. 2012)
(Fig. 1), while NDA2 and NDA3 were found to be located in the chloroplast (Jans
et al. 2008; Terashima et al. 2010). The loss of NDA1 was correlated to a slight
decrease of NADH dehydrogenase activity, but no impact on heterotrophic growth
was observed. However, when coupled to a complex I mutation, severe respiratory
and growth defects could be observed, underlining the importance of the enzyme in
NADH oxidation in the absence of complex I (Lecler et al. 2012).
Acknowledgments Simon Massoz is a recipient of PhD FRIA fellowship (Fond pour la formation a
la Recherche dans l’Industrie et dans l’Agriculture). Pierre Cardol is a research associate from F.R.S.-
FNRS (Fond de la Recherche Scientifique). Technical support from Q.B.P. Miriam Vázquez-Acevedo
and financial support from grants 245486 from CONACyT-F.R.S.-FNRS (Mexico-Belgium) and
from grants 239219 (CONACyT, Mexico), IN203311-3 (DGAPA-UNAM, Mexico) and MIS
F.4520, FRFC 2.4597, CDR J.0032 and CDR J.0265.17 (Belgian F.R.S.-FNRS) are also gratefully
acknowledged.
References
Allegretti M, Klusch N, Mills DJ et al (2015) Horizontal membrane-intrinsic α-helices in the stator

a-subunit of an F-type ATP synthase. Nature 521:237–240. doi:10.1038/nature14185
Allen JWA, Jackson AP, Rigden DJ et al (2008) Order within a mosaic distribution of mitochondrial
c-type cytochrome biogenesis systems? FEBS J 275:2385–2402. doi:10.1111/j.1742-4658.2008.
06380.x
Arselin G, Vaillier J, Salin B et al (2004) The modulation in subunits e and g amounts of yeast ATP
synthase modifies mitochondrial cristae morphology. J Biol Chem 279:40392–40399. doi:10.1074/
jbc.M404316200
Atteia A, Adrait A, Brugire S et al (2009) A proteomic survey of Chlamydomonas reinhardtii
mitochondria sheds new light on the metabolic plasticity of the organelle and on the nature of
the α-proteobacterial mitochondrial ancestor. Mol Biol Evol 26:1533–1548. doi:10.1093/
molbev/msp068
Baradaran R, Berrisford JM, Minhas GS, Sazanov LA (2013) Crystal structure of the entire
respiratory complex I. Nature 494:443–448. doi:10.1038/nature11871
Barbieri MR, Larosa V, Nouet C, Subrahmanian N, Remacle C, Hamel PP (2011) A forward genetic
screen identifies mutants deficient for mitochondrial complex I assembly in Chlamydomonas
reinhardtii. Genetics 188:349–358. doi:10.1534/genetics
Barrientos A, Gouget K, Horn D et al (2009) Suppression mechanisms of COX assembly defects in
yeast and human: Insights into the COX assembly process. Biochim Biophys Acta, Mol Cell
Res 1793:97–107. doi:10.1016/j.bbamcr.2008.05.003
Barros MH, Carlson CG, Glerum DM, Tzagoloff A (2001) Involvement of mitochondrial ferredoxin
and Cox15p in hydroxylation of heme O. FEBS Lett 492:133–138. doi:10.1016/S0014-5793(01)
02249-9
Bernard DG, Gabilly ST, Dujardin G et al (2003) Overlapping specificities of the mitochondrial
cytochrome c and c 1 heme lyases. J Biol Chem 278:49732–49742. doi:10.1074/jbc.M308881200
Berrisford JM, Baradaran R, Sazanov LA (2016) Structure of bacterial respiratory complex
I. Biochim Biophys Acta Bioenergetics. doi:10.1016/j.bbabio.2016.01.012
Brandt U (2011) A two-state stabilization-change mechanism for proton-pumping complex
i. Biochim Biophys Acta Bioenerg 1807:1364–1369. doi:10.1016/j.bbabio.2011.04.006
Brasseur G, Tron P, Dujardin G, Slonimski P (1997) The nuclear ABCl gene is essential for the
correct conformation and functioning of the cytochrome bc, complex and the neighbouring
complexes II and IV in the mitochondrial respiratory chain. Eur J Biochem 246:103–111
Bricker DK, Taylor EB, Schell JC et al (2012) A mitochondrial pyruvate carrier required for pyruvate
uptake in yeast, Drosophila, and humans. Science 337:96–100. doi:10.1126/science.1218099
Cano-Estrada A, Vazquez-Acevedo M, Villavicencio-Queijeiro A et al (2010) Subunit-subunit
interactions and overall topology of the dimeric mitochondrial ATP synthase of Polytomella
sp. Biochim Biophys Acta Bioenerg 1797:1439–1448. doi:10.1016/j.bbabio.2010.02.024
Cardol P (2011) Mitochondrial NADH:Ubiquinone oxidoreductase (complex I) in eukaryotes: a
highly conserved subunit composition highlighted by mining of protein databases. Biochim
Biophys Acta Bioenerg 1807:1390–1397. doi:10.1016/j.bbabio.2011.06.015
Cardol P, Matagne RF, Remacle C (2002) Impact of mutations affecting ND mitochondria-encoded
subunits on the activity and assembly of complex I in chlamydomonas. Implication for the
structural organization of the enzyme. J Mol Biol 319:1211–1221. doi:10.1016/S0022-2836(02)
00407-2
Cardol P, Gloire G, Havaux M et al (2003) Photosynthesis and state transitions in mitochondrial
mutants of Chlamydomonas reinhardtii affected in respiration. Plant Physiol 133:2010–2020.
doi:10.1104/pp.103.028076.transition
Cardol P, Vanrobaeys F, Devreese B et al (2004) Higher plant-like subunit composition of
mitochondrial complex I from Chlamydomonas reinhardtii: 31 conserved components
among eukaryotes. Biochim Biophys Acta Bioenerg 1658:212–224. doi:10.1016/j.bbabio.
2004.06.001
Cardol P, González-Halphen D, Reyes-Prieto A et al (2005) The mitochondrial oxidative phosphor-
ylation proteome of Chlamydomonas reinhardtii deduced from the Genome Sequencing Project.
Plant Physiol 137:447–459. doi:10.1104/pp.104.054148
88 S. Massoz et al.
Cardol P, Lapaille M, Minet P et al (2006) ND3 and ND4L subunits of mitochondrial complex I,
both nucleus encoded in Chlamydomonas reinhardtii, are required for activity and assembly of
the enzyme. Eukaryot Cell 5:1460–1467. doi:10.1128/EC.00118-06
Cardol P, Boutaffala L, Memmi S et al (2008) In Chlamydomonas, the loss of ND5 subunit
prevents the assembly of whole mitochondrial complex I and leads to the formation of a low
abundant 700 kDa subcomplex. Biochim Biophys Acta Bioenerg 1777:388–396. doi:10.1016/
j.bbabio.2008.01.001
Cardol P, Alric J, Girard-bascou J, Franck F et al (2009a) Impaired respiration discloses the
physiological significance of state transitions in Chlamydomonas. Proc Natl Acad Sci USA
106:15979–15984
Cardol P, Figueroa F, Remacle C, et al (2009b). Oxidative phosphorylation: building blocks and
related component. The Chlamydomonas sourcebook, 2nd edn, 2, pp 469–503
Cheng VWT, Piragasam RS, Rothery RA et al (2015) Redox state of flavin adenine dinucleotide
drives substrate binding and product release in Escherichia coli succinate dehydrogenase.
Biochemistry 54:1043–1052. doi:10.1021/bi501350j.Redox
Colin M, Dorthu MP, Duby F et al (1995) Mutations affecting the mitochondrial genes encoding
the cytochrome oxidase subunit I and apocytochrome b of Chlamydomonas reinhardtii. Mol
Gen Genet 249:179–184. doi:10.1007/bf00290364
Colina-Tenorio L, Miranda-Astudillo H, Cano-Estrada A et al (2015) Subunit Asa1 spans all the
peripheral stalk of the mitochondrial ATP synthase of the chlorophycean alga polytomella
sp. Biochim Biophys Acta Bioenerg 1857:359–369. doi:10.1016/j.bbabio.2015.11.012
Conte A, Papa B, Ferramosca A, Zara V (2015) The dimerization of the yeast cytochrome bc
1 complex is an early event and is independent of Rip1. Biochim Biophys Acta Mol Cell Res
1853:987–995. doi:10.1016/j.bbamcr.2015.02.006
Dibrov E, Fu S, Lemire BD (1999) The Saccharomyces cerevisiae TCM62 gene encodes a
chaperone necessary for the assembly of the mitochondrial succinate dehydrogenase (complex
II). J Biol Chem 273:32042–32048. doi:10.1074/jbc.273.48.32042
Dickson VK, Silvester JA, Fearnley IM et al (2006) On the structure of the stator of the
mitochondrial ATP synthase. EMBO J 25:2911–2918. doi:10.1038/sj.emboj.7601177
Dinant M, Baurain D, Coosemans N et al (2001) Characterization of two genes encoding the
mitochondrial alternative oxidase in Chlamydomonas reinhardtii. Curr Genet 39:101–108.
doi:10.1007/s002940000183
Do TQ, Hsu AY, Jonassen T et al (2001) A defect in coenzyme Q biosynthesis is responsible for
the respiratory deficiency in Saccharomyces cerevisiae abc1 mutants. J Biol Chem
276:18161–18168. doi:10.1074/jbc.M100952200
Dorthu MP, Remy S, Michel-Wolwertz MR et al (1992) Biochemical, genetic and molecular
characterization of new respiratory-deficient mutants in Chlamydomonas reinhardtii. Plant
Mol Biol 18:759–772
Drapier D, Rimbault B, Vallon O et al (2007) Intertwined translational regulations set uneven
stoichiometry of chloroplast ATP synthase subunits. EMBO J 26:3581–3591. doi:10.1038/sj.
emboj.7601802
Duarte M, Mota N, Pinto L, Videira A (1998) Inactivation of the gene coding for the 30.4-kDa
subunit of respiratory chain NADH dehydrogenase: Is the enzyme essential for Neurospora?
Mol Gen Genet 257:368–375. doi:10.1007/s004380050659
Dudkina NV, Heinemeyer J, Keegstra W et al (2005) Structure of dimeric ATP synthase from
mitochondria: An angular association of monomers induces the strong curvature of the inner
membrane. FEBS Lett 579:5769–5772. doi:10.1016/j.febslet.2005.09.065
Dudkina NV, Sunderhaus S, Braun HP, Boekema EJ (2006) Characterization of dimeric ATP
synthase and cristae membrane ultrastructure from Saccharomyces and Polytomella mitochon-
dria. FEBS Lett 580:3427–3432. doi:10.1016/j.febslet.2006.04.097
Dudkina NV, Oostergetel GT, Lewejohann D et al (2010) Row-like organization of ATP synthase
in intact mitochondria determined by cryo-electron tomography. Biochim Biophys Acta
Bioenerg 1797:272–277. doi:10.1016/j.bbabio.2009.11.004
Dumont ME, Ernst JF, Hampsey DM, Sherman F (1987) Identification and sequence of the gene
encoding cytochrome c heme lyase in the yeast Saccharomyces cerevisiae. EMBO J 6:235–241
Efremov RG, Sazanov LA (2011) Structure of the membrane domain of respiratory complex
I. Supplementary information. Nature 476:414–420. doi:10.1038/nature10330
Efremov RG, Baradaran R, Sazanov LA (2010) The architecture of respiratory complex I. Nature
465:441–445. doi:10.1038/nature09066
Eletsky A, Jeong M, Kim H et al (2012) Solution NMR structure of yeast succinate dehydrogenase
flavinylation factor Sdh5 reveals a putative Sdh1 binding site. Biochemistry 51:8475–8477.
doi:10.1038/nature13314.A
Figueroa-Martinez F, Nedelcu AM, Smith DR, Reyes-Prieto A (2015) When the lights go out: the
evolutionary fate of free-living colorless green algae. New Phytol 206:972–982. doi:10.1111/
nph.13279
Francis BR, Thorsness PE (2011) Hsp90 and mitochondrial proteases Yme1 and Yta10/12
participate in ATP synthase assembly in Saccharomyces cerevisiae. Mitochondrion
11:587–600. doi:10.1016/j.mito.2011.03.008
Franzén LG, Falk G (1992) Nucleotide sequence of cDNA clones encoding the β subunit of
mitochondrial ATP synthase from the green alga Chlamydomonas reinhardtii: the precursor
protein encoded by the cDNA contains both an N-terminal presequence and a C-terminal
extension. Plant Mol Biol 19:771–780. doi:10.1007/BF00027073
Friedrich T, Weiss H (1997) Modular evolution of the respiratory NADH:ubiquinone oxidoreduc-
tase and the origin of its modules. J Theor Biol 187:529–540. doi:10.1006/jtbi.1996.0387
Fromm S, Braun H, Peterhansel C (2016) Mitochondrial gamma carbonic anhydrases are required
for complex I assembly and plant reproductive development. New Phytol 211:194–207. doi:10.
1111/nph.13886
Funes S, Davidson E, Gonzalo Claros M et al (2002) The typically mitochondrial DNA-encoded
ATP6 subunit of the F1F0-ATPase is encoded by a nuclear gene in Chlamydomonas
reinhardtii. J Biol Chem 277:6051–6058. doi:10.1074/jbc.M109993200
Ghezzi D, Arzuffi P, Zordan M et al (2011) Mutations in TTC19 cause mitochondrial complex III
deficiency and neurological impairment in humans and flies. Nat Genet 43:259–263. doi:10.1038/
ng.761
Glaser E, Dessi P (1999) Integration of the mitochondrial-processing peptidase into the cytochrome
bc1 complex in plants. J Bioenerg Biomembr 31:259–274. doi:10.1023/A:1005475930477
Gledhill JR, Walker JE (2005) Inhibition sites in F1-ATPase from bovine heart mitochondria.
Biochem J 386:591–598. doi:10.1042/BJ20041513
Goodenough U, Blaby I, Casero D et al (2014) The path to triacylglyceride obesity in the sta6
strain of Chlamydomonas reinhardtii. Eukaryot Cell 13:591–613. doi:10.1128/EC.00013-14
Gruschke S, Kehrein K, R€ ompler K et al (2011) Cbp3-Cbp6 interacts with the yeast mitochondrial
ribosomal tunnel exit and promotes cytochrome b synthesis and assembly. J Cell Biol
193:1101–1114. doi:10.1083/jcb.201103132
Gruschke S, R€ompler K, Hildenbeutel M et al (2012) The Cbp3–Cbp6 complex coordinates
cytochrome. J Cell Biol 199:137–150. doi:10.1083/jcb.201206040
Guarani V, Paulo J, Zhai B et al (2014) TIMMDC1/C3orf1 functions as a membrane-embedded
mitochondrial complex I assembly factor through association with the MCIA complex. Mol
Cell Biol 34:847–861. doi:10.1128/MCB.01551-13
Haltia T, Finel M, Harms N et al (1989) Deletion of the gene for subunit III leads to defective
assembly of bacterial cytochrome oxidase. EMBO J 8:594–596
Hamaji T, Smith DR, Noguchi H et al (2013) Mitochondrial and plastid genomes of the colonial
green alga gonium pectorale give insights into the origins of organelle DNA architecture within
the volvocales. PLoS One. doi:10.1371/journal.pone.0057177
Hao H, Khalimonchuk O, Schraders M et al (2009) SDH5, a gene required for flavination of
succinate dehydrogenase is mutated in paraganglioma. Science 325:1139–1142
90 S. Massoz et al.
Helfenbein KG, Ellis TP, Dieckmann CL, Tzagoloff A (2003) ATP22, a nuclear gene required for
expression of the F0 sector of mitochondrial ATPase in Saccharomyces cerevisiae. J Biol
Chem 278:19751–19756. doi:10.1074/jbc.M301679200
Hirst J, Carroll J, Fearnley IM et al (2003) The nuclear encoded subunits of complex I from bovine
heart mitochondria. Biochim Biophys Acta Bioenerg 1604:135–150. doi:10.1016/S0005-2728
(03)00059-8
Hofhaus G, Attardi G (1993) Lack of assembly of mitochondrial DNA-encoded subunits of
respiratory NADH dehydrogenase and loss of enzyme activity in a human cell mutant lacking
the mitochondrial ND4 gene product. EMBO J 12:3043–3048
Hosler JP (2004) The influence of subunit III of cytochrome c oxidase on the D pathway, the
proton exit pathway and mechanism-based inactivation in subunit I. Biochim Biophys Acta
Bioenerg 1655:332–339. doi:10.1016/j.bbabio.2003.06.009
Hummer G, Wikstr€om M (2016) Molecular simulation and modeling of complex I. Biochim
Biophys Acta Bioenerg:1–7. doi:10.1016/j.bbabio.2016.01.005
Jans F, Mignolet E, Houyoux P-A et al (2008) A type II NAD(P)H dehydrogenase mediates light-
independent plastoquinone reduction in the chloroplast of Chlamydomonas. Proc Natl Acad
Sci USA 105:20546–20551. doi:10.1073/pnas.0806896105
Jia L, Dienhart MK, Stuart RA (2007) Oxa1 directly interacts with Atp9 and mediates its assembly
into the mitochondrial F1Fo-ATP synthase complex. Mol Biol Cell 18:986–994. doi:10.1091/
mbc.E06
Kaila VR, Verkhovsky MI, Wikstr€ om M (2010) Proton-coupled electron transfer in cytochrome
oxidase. Chem Rev 110:7062–7081. doi:10.1021/cr1002003
Karpova OV, Newton KJ (1999) A partially assembled complex I in NAD4-deficient mitochondria
of maize. Plant J 17:511–521. doi:10.1046/j.1365-313X.1999.00401.x
Kerscher S, Kashani-poor N, Zwicker K et al (2001) Exploring the catalytic core of complex I by
Yarrowia lipolytica yeast genetics. J Bioenerg Biomembr 33(3):187–196
Klodmann J, Braun H-P (2011) Proteomic approach to characterize mitochondrial complex I from
plants. Phytochemistry 72:1071–1080. doi:10.1016/j.phytochem.2010.11.012
Klodmann J, Sunderhaus S, Nimtz M et al (2010) Internal architecture of mitochondrial complex I
from Arabidopsis thaliana. Plant Cell 22:797–810. doi:10.1105/tpc.109.073726
Kmita K, Wirth C, Warnau J et al (2015) Accessory NUMM (NDUFS6) subunit harbors a
Zn-binding site and is essential for biogenesis of mitochondrial complex I. Proc Natl Acad
Sci 112:201424353. doi:10.1073/pnas.1424353112
Kotlyar AB, Sled VD, Burbaev DS et al (1990) Coupling site I and the rotenone-sensitive
ubisemiquinone in tightly coupled submitochondrial particles. FEBS Lett 264:17–20.
doi:10.1016/0014-5793(90)80753-6
Kunze M, Hartig A (2013) Permeability of the peroxisomal membrane: lessons from the
glyoxylate cycle. Front Physiol 4:1–12. doi:10.3389/fphys.2013.00204
Lang FB, Burger G, O’Kelly CJ, Cedergren R et al (1997) An ancestral mitochondrial genome
resembling a eubacterial genome in miniature. Nature 387:493–497
Lapaille M, Escobar-Ramı́rez A, Degand H et al (2010) Atypical subunit composition of the
chlorophycean mitochondrial F 1FO-ATP synthase and role of asa7 protein in stability and
oligomycin resistance of the enzyme. Mol Biol Evol 27:1630–1644. doi:10.1093/molbev/msq049
Lauersen K, Willamme R, Coosemans N et al (2016) Peroxisomal microbodies are at the
crossroads of acetate assimilation in the green microalga Chlamydomonas reinhardtii. Algal
Res 16:266–274
Lecler R, Cardol P, Remacle C, Barbare E (2012) Characterization of an internal type-II NADH
dehydrogenase from Chlamydomonas reinhardtii mitochondria. Curr Genet 58:205–216.
doi:10.1007/s00294-012-0378-2
Lefebvre-Legendre L, Vaillier J, Benabdelhak H et al (2001) Identification of a nuclear gene
(FMC1) required for the assembly/stability of yeast mitochondrial F(1)-ATPase in heat stress
conditions. J Biol Chem 276:6789–6796. doi:10.1074/jbc.M009557200
Li X, Zhang R, Patena W et al (2016) An indexed, mapped mutant library enables reverse genetics
studies of biological processes in Chlamydomonas reinhardtii. Plant Cell. doi:10.1105/tpc.16.
00465
Lown FJ, Watson AT, Purton S (2001) Chlamydomonas nuclear mutants that fail to assemble
respiratory or photosynthetic electron transfer complexes. Biochem Soc Trans 29:452–455.
doi:10.1042/BST0290452
Massoz S, Larosa V, Plancke C et al (2014) Inactivation of genes coding for mitochondrial Nd7
and Nd9 complex I subunits in Chlamydomonas reinhardtii. Impact of complex I loss on
respiration and energetic metabolism. Mitochondrion 19:365–374. doi:10.1016/j.mito.2013.
11.004
Massoz S, Larosa V, Horrion B et al (2015) Isolation of Chlamydomonas reinhardtii mutants with
altered mitochondrial respiration by chlorophyll fluorescence measurement. J Biotechnol
215:27–34. doi:10.1016/j.jbiotec.2015.05.009
Mathiesen C, Hägerhäll C (2002) Transmembrane topology of the NuoL, M and N subunits of
NADH:quinone oxidoreductase and their homologues among membrane-bound hydrogenases
and bona fide antiporters. Biochim Biophys Acta Bioenerg 1556:121–132. doi:10.1016/S0005-
2728(02)00343-2
Mathieu L, Marsy S, Saint-Georges Y et al (2011) A transcriptome screen in yeast identifies a novel
assembly factor for the mitochondrial complex III. Mitochondrion 11:391–396. doi:10.1016/j.mito.
2010.12.002
Mathy G, Cardol P, Dinant M et al (2010) Proteomic and functional characterization of a
Chlamydomonas reinhardtii mutant lacking the mitochondrial alternative oxidase. J Proteome
Res 9:2825–2838. doi:10.1021/pr900866e
Mavridou DAI, Ferguson SJ, Stevens JM (2013) Cytochrome c assembly. IUBMB Life
65:209–216. doi:10.1002/iub.1123
McCommis KS, Finck BN (2015) Mitochondrial pyruvate transport: a historical perspective and
future research directions. Biochem J 466:229–262. doi:10.1007/978-1-4614-5915-6
Merchant SS, Prochnik SE, Vallon O et al (2007) The Chlamydomonas genome reveals the
evolution of key animal and plant functions. Science 318:245–252
Milani G, Jarmurszkiewicz W, Sluse-Goffart CM et al (2001) Respiratory chain network in
mitochondria of Candida parapsilosis: ADP/O appraisal of the multiple electron pathways.
FEBS Lett 508:231–235
Mimaki M, Wang X, McKenzie M et al (2012) Understanding mitochondrial complex I assembly
in health and disease. Biochim Biophys Acta Bioenerg 1817:851–862. doi:10.1016/j.bbabio.
2011.08.010
Miranda-Astudillo H, Cano-Estrada A, Vazquez-Acevedo M et al (2014) Interactions of subunits
Asa2, Asa4 and Asa7 in the peripheral stalk of the mitochondrial ATP synthase of the
chlorophycean alga Polytomella sp. Biochim Biophys Acta Bioenerg 1837:1–13. doi:10.1016/j.
bbabio.2013.08.001
Molen TA, Rosso D, Piercy S, Maxwell DP (2006) Characterization of the alternative oxidase of
Chlamydomonas reinhardtii in response to oxidative stress and a shift in nitrogen source.
Physiol Plant 127:74–86. doi:10.1111/j.1399-3054.2006.00643.x
Møller IM, Rasmusson AG, Fredlund KM (1993) NAD(P)H-ubiquinone oxidoreductases in plant
mitochondria. J Bioenerg Biomembr 25:377–384. doi:10.1007/BF00762463
Nurani G, Franzén LG (1996) Isolation and characterization of the mitochondrial ATP synthase
from Chlamydomonas reinhardtii. cDNA sequence and deduced protein sequence of the alpha
subunit. Plant Mol Biol 31:1105–1116
Ohnishi T (1998) Iron-sulfur clusters/semiquinones in complex I. Biochim Biophys Acta Bioenerg
1364:186–206. doi:10.1016/S0005-2728(98)00027-9
Oster G, Wang H (2003) Rotary protein motors. Trends Cell Biol 13:114–121. doi:10.1016/S0962-
8924(03)00004-7
92 S. Massoz et al.
Oyedotun KS, Sit CS, Lemire BD (2007) The Saccharomyces cerevisiae succinate dehydrogenase
does not require heme for ubiquinone reduction. Biochim Biophys Acta Bioenerg
1767:1436–1445. doi:10.1016/j.bbabio.2007.09.008
Paumard P, Vaillier J, Coulary B et al (2002) The ATP synthase is involved in generating
mitochondrial cristae morphology. EMBO J 21:221–230. doi:10.1093/emboj/21.3.221
Paupe V, Prudent J, Dassa EP et al (2015) CCDC90A (MCUR1) is a cytochrome c oxidase
assembly factor and not a regulator of the mitochondrial calcium uniporter. Cell Metab
21:109–116. doi:10.1016/j.cmet.2014.12.004
Perez-Martinez X, Antaramian A, Vazquez-Acevedo M et al (2001) Subunit II of cytochrome c
oxidase in Chlamydomonas algae is a heterodimer encoded by two independent nuclear genes.
J Biol Chem 276:11302–11309. doi:10.1074/jbc.M010244200
Perez-Martinez X, Funes S, Tolkunova E et al (2002) Structure of nuclear-localized cox3 genes in
Chlamydomonas reinhardtii and in its colorless close relative Polytomella sp. Curr Genet
40:399–404. doi:10.1007/s00294-002-0270-6
Phillips JD, Graham LA, Trumpower BL (1993) Subunit 9 of the Saccharomyces cerevisiae
cytochrome bc1 complex is required for insertion of EPR-detectable iron-sulfur cluster into
the Rieske iron-sulfur protein. J Biol Chem 268:11727–11736
Plancke C, Vigeolas H, H€ ohner R et al (2014) Lack of isocitrate lyase in Chlamydomonas leads to
changes in carbon metabolism and in the response to oxidative stress under mixotrophic
growth. Plant J 77:404–417. doi:10.1111/tpj.12392
Prakash SK, Cormier TA, Mccall AE et al (2002) Loss of holocytochrome c-type synthetase
causes the male lethality of X-linked dominant microphthalmia with linear skin defects (MLS)
syndrome. Hum Mol Genet 11:3237–3248
Rak M, Gokova S, Tzagoloff A (2011) Modular assembly of yeast mitochondrial ATP synthase.
EMBO J 30:920–930. doi:10.1038/emboj.2010.364
Remacle C, Baurain D, Cardol P, Matagne F (2001) Mutants of Chlamydomonas reinhardtii
deficient in mitochondrial complex I: characterization of two mutations affecting the nd1
coding sequence. Genetics 158:1051–1060
Remacle C, Coosemans N, Jans F et al (2010) Knock-down of the COX3 and COX17 gene
expression of cytochrome c oxidase in the unicellular green alga Chlamydomonas reinhardtii.
Plant Mol Biol 74:223–233. doi:10.1007/s11103-010-9668-6
Rhein VF, Carroll J, Ding S et al (2013) NDUFAF7 methylates arginine 85 in the NDUFS2 subunit
of human complex i. J Biol Chem 288:33016–33026. doi:10.1074/jbc.M113.518803
Rodriguez-Salinas E, Riveros-Rosas H, Li Z et al (2012) Lineage-specific fragmentation and
nuclear relocation of the mitochondrial cox2 gene in chlorophycean green algae (Chlorophyta).
Mol Phylogenet Evol 64:166–176. doi:10.1016/j.ympev.2012.03.014
Rouault TA (2015) Mammalian iron-sulphur proteins: novel insights into biogenesis and function.
Nat Rev Mol Cell Biol 16:45–55. doi:10.1038/nrm3909
Rühle T, Leister D (2015) Assembly of F1F0-ATP synthases. Biochim Biophys Acta
1847:849–860. doi:10.1016/j.bbabio.2015.02.005
Rutter J, Winge DR, Schiffman JD (2010) Succinate dehydrogenase – assembly, regulation and
role in human disease. Mitochondrion 10:393–401. doi:10.1016/j.mito.2010.03.001
Saada A, Vogel RO, Hoefs SJ et al (2009) Mutations in NDUFAF3 (C3ORF60), encoding an
NDUFAF4 (C6ORF66)-interacting complex I assembly protein, cause fatal neonatal mito-
chondrial disease. Am J Hum Genet 84:718–727. doi:10.1016/j.ajhg.2009.04.020
Salinas T, Larosa V, Cardol P et al (2014) Biochimie respiratory-deficient mutants of the
unicellular green alga Chlamydomonas: a review. Biochimie 100:207–218. doi:10.1016/j.
biochi.2013.10.006
Sánchez-Caballero L, Guerrero-Castillo S, Nijtmans L (2016) Unraveling the complexity of
mitochondrial complex I assembly; a dynamic process. Biochim Biophys Acta Bioenerg.
doi:10.1016/j.bbabio.2016.03.031
Sazanov LA (2015) A giant molecular proton pump: structure and mechanism of respiratory
complex I. Nat Rev Mol Cell Biol 16:375–388. doi:10.1038/nrm3997
Sazanov LA, Hinchliffe P (2006) Structure of the hydrophilic domain. Science 311:1430–1437
Schimmeyer J, Bock R, Meyer EH (2016) l-Galactono-1,4-lactone dehydrogenase is an assembly
factor of the membrane arm of mitochondrial complex I in Arabidopsis. Plant Mol Biol
90:117–126. doi:10.1007/s11103-015-0400-4
Schulte U, Weiss H (1995) Generation and characterization of NADH: ubiquinone oxidoreductase
mutants in Neurospora crassa. Methods Enzymol 260:3–13
Sharma V, Belevich G, Gamiz-Hernandez AP et al (2015) Redox-induced activation of the proton
pump in the respiratory complex I. Proc Natl Acad Sci USA 112:11571–11576. doi:10.1073/
pnas.1503761112
Sheftel AD, Stehling O, Pierik AJ et al (2009) Human ind1, an iron-sulfur cluster assembly factor
for respiratory complex I. Mol Cell Biol 29:6059–6073. doi:10.1128/MCB.00817-09
Shiba T, Kido Y, Sakamoto K et al (2013) Structure of the trypanosome cyanide-insensitive
alternative oxidase. Proc Natl Acad Sci USA 110:4580–4585. doi:10.1073/pnas.1218386110
Siedow JN, Umbach AL, Moore AL (1995) The active site of the cyanide-resistant oxidase from
plant mitochondria contains a binuclear iron center. FEBS Lett 362:10–14. doi:10.1016/0014-
5793(95)00196-G
Smith DR, Lee RW (2009) The mitochondrial and plastid genomes of Volvox carteri: bloated
molecules rich in repetitive DNA. BMC Genomics 10:132. doi:10.1186/1471-2164-10-132
Smith DR, Hua J, Lee RW (2010) Evolution of linear mitochondrial DNA in three known lineages
of Polytomella. Curr Genet 56:427–438. doi:10.1007/s00294-010-0311-5
Smith PM, Fox JL, Winge DR (2012) Biogenesis of the cytochrome bc 1 complex and role of
assembly factors. Biochim Biophys Acta Bioenerg 1817:276–286. doi:10.1016/j.bbabio.2011.
11.009
Soto IC, Fontanesi F, Liu J, Barrientos A (2012) Biogenesis and assembly of eukaryotic cyto-
chrome c oxidase catalytic core. Biochim Biophys Acta Bioenerg 1817:883–897. doi:10.1016/
j.bbabio.2011.09.005
Subrahmanian N, Remacle C, Hamel PP (2016) Plant mitochondrial complex I composition and
assembly: a review. Biochim Biophys Acta Bioenerg. doi:10.1016/j.bbabio.2016.01.009
Sun F, Huo X, Zhai Y et al (2005) Crystal structure of mitochondrial respiratory membrane protein
complex II. Cell 121:1043–1057. doi:10.1016/j.cell.2005.05.025
Sunderhaus S, Dudkina NV, Jansch L et al (2006) Carbonic anhydrase subunits form a matrix-
exposed domain attached to the membrane arm of mitochondrial complex I in plants. J Biol
Chem 281:6482–6488. doi:10.1074/jbc.M511542200
Svensson-Ek M, Abramson J, Larsson G et al (2002) The X-ray crystal structures of wild-type and
EQ(I-286) mutant cytochrome c oxidases from Rhodobacter sphaeroides. J Mol Biol
321:329–339. doi:10.1016/S0022-2836(02)00619-8
Chlamydomonas reinhardtii by quantitative proteomics. Mol Cell Proteomics 9:1514–1532.
doi:10.1074/mcp.M900421-MCP200
Trumpower B (1990a) The protonmotive Q cycle. J Biol Chem 265:11409–11412. doi:10.3109/
10409239409086800
Trumpower BL (1990b) Cytochrome bc1 complexes of microorganisms. Microbiol Rev
54:101–129
Tucker EJ, Wanschers BFJ, Szklarczyk R et al (2013) Mutations in the UQCC1-interacting
protein, UQCC2, cause human complex III deficiency associated with perturbed cytochrome
b protein expression. Genetics. doi:10.1371/journal.pgen.1004034
Tzagoloff A, Jang J, Glerum M, Wu M (1996) FLX1 codes for a carrier protein involved in
maintaining a proper balance of flavin nucleotides in yeast mitochondria. J Biol Chem
271:7392–7397
Un N, Yu YD, Cox J et al (2014) The LYR factors SDHAF1 and SDHAF3 mediate maturation of
the iron-sulfur subunit of succinate dehydrogenase. Cell Metab:253–266. doi:10.1021/
jf104742n.Biological
94 S. Massoz et al.
Vahrenholz C, Riemen G, Pratje E et al (1993) Mitochondrial DNA of Chlamydomonas

reinhardtii: the structure of the ends of the linear 15.8-kb genome suggests mechanisms for
DNA replication. Curr Genet 24:241–247. doi:10.1007/BF00351798
Van Den Brand AM, Jonckheere A, Wanschers BFJ et al (2014) A mutation in the human CBP4
ortholog UQCC3 impairs complex III assembly, activity and cytochrome b stability. Hum Mol
Genet 23:6356–6365. doi:10.1093/hmg/ddu357
van Lis R, Atteia A, Mendoza-hernández G, González-halphen D (2003) Identification of novel
mitochondrial protein components of Chlamydomonas reinhardtii. A proteomic approach.
Plant Physiol 132:318–330. doi:10.1104/pp.102.018325.proteins
van Lis R, Mendoza-Hernández G, Groth G, Atteia A (2007) New insights into the unique
structure of the F0F1-ATP synthase from the chlamydomonas algae Polytomella sp. and
Chlamydomonas reinhardtii. Plant Physiol 144:1190–1199. doi:10.1104/pp.106.094060
Van Vranken J, Na U, Winge DR, Rutter J (2015) Protein-mediated assembly of succinate
dehydrogenase and its cofactors. Crit Rev Biochem Mol Biol 50:168–180. doi:10.1530/ERC-
14-0411.Persistent
Vazquez-Acevedo M, Cardol P, Cano-Estrada A et al (2006) The mitochondrial ATP synthase of
chlorophycean algae contains eight subunits of unknown origin involved in the formation of an
atypical stator-stalk and in the dimerization of the complex. J Bioenerg Biomembr 38:271–282.
doi:10.1007/s10863-006-9046-x
Vázquez-Acevedo M, Vega-deLuna F, Sánchez-Vásquez L et al (2016) Dissecting the peripheral
stalk of the mitochondrial ATP synthase of chlorophycean algae. Biochim Biophys Acta
Bioenerg. doi:10.1016/j.bbabio.2016.02.003
Vignais PM, Billoud B (2007) Occurrence, classification, and biological function of hydrogenases:
an overview. Chem Rev 107:4206–4272
Villavicencio-Queijeiro A, Vázquez-Acevedo M, Cano-Estrada A, Zarco-Zavala M, Tuena de
Gómez M, Mignaco JA, Freire MM, Scofano HM, Foguel D, Cardol P, Remacle C, González-
Halphen D (2009) The fully-active and structurally-stable form of the mitochondrial ATP
synthase of Polytomella sp. is dimeric. J Bioenerg Biomembr 41:1–13. doi:10.1007/s10863-
009-9203-0
Villavicencio-Queijeiro A, Pardo JP, Gonzalez-Halphen D (2015) Kinetic and hysteretic behavior
of ATP hydrolysis of the highly stable dimeric ATP synthase of Polytomella sp. Arch Biochem
Biophys 575:30–37. doi:10.1016/j.abb.2015.03.018
Vinothkumar KR, Zhu J, Hirst J (2014) Architecture of mammalian respiratory complex I. Nature
515:80–84. doi:10.1038/nature13686.Architecture
Vogel RO, Dieteren CEJ, Van Den Heuvel LP et al (2007) Identification of mitochondrial complex
I assembly intermediates by tracing tagged NDUFS3 demonstrates the entry point of mito-
chondrial subunits. J Biol Chem 282:7582–7590. doi:10.1074/jbc.M609410200
Wächter A, Bi Y, Dunn SD et al (2011) Two rotary motors in F-ATP synthase are elastically
coupled by a flexible rotor and a stiff stator stalk. Proc Natl Acad Sci USA 108:3924–3929.
doi:10.1073/pnas.1011581108
Walker JE, Dickson VK (2006) The peripheral stalk of the mitochondrial ATP synthase. Biochim
Biophys Acta Bioenerg 1757:286–296. doi:10.1016/j.bbabio.2006.01.001
Wang ZG, White PS, Ackerman SH (2001) Atp11p and Atp12p are assembly factors for the
F1-ATPase in human mitochondria. J Biol Chem 276:30773–30778. doi:10.1074/jbc.
M104133200
Wenz T, Hielscher R, Hellwig P et al (2009) Role of phospholipids in respiratory cytochrome bc1
complex catalysis and supercomplex formation. Biochim Biophys Acta Bioenerg
1787:609–616. doi:10.1016/j.bbabio.2009.02.012
Wikstr€om M, Jasaitis A, Backgren C et al (2000) The role of the D- and K-pathways of proton
transfer in the function of the haem-copper oxidases. Biochim Biophys Acta Bioenerg
1459:514–520. doi:10.1016/S0005-2728(00)00191-2
Wydro MM, Sharma P, Foster JM et al (2013) The evolutionarily conserved iron-sulfur protein
INDH is required for complex I assembly and mitochondrial translation in Arabidopsis. Plant
Cell 25:4014–4027. doi:10.1105/tpc.113.117283
Xia D, Esser L, Tang WK et al (2013) Structural analysis of cytochrome bc1 complexes:
Implications to the mechanism of function. Biochim Biophys Acta Bioenerg
1827:1278–1294. doi:10.1016/j.bbabio.2012.11.008
Yasuda R, Noji H, Kinosita K, Yoshida M (1998) F1-ATPase is a highly efficient molecular motor
that rotates with discrete 120 degree steps. Cell 93:1117–1124. doi:10.1016/S0092-8674(00)
81456-7
Zalutskaya Z, Lapina T, Ermilova E (2015) The Chlamydomonas reinhardtii alternative oxidase
1 is regulated by heat stress. Plant Physiol Biochem 97:229–234. doi:10.1016/j.plaphy.2015.
10.014
Zara V, Conte L, Trumpower BL (2007) Identification and characterization of cytochrome bc1
subcomplexes in mitochondria from yeast with single and double deletions of genes encoding
cytochrome bc1 subunits. FEBS J 274:4526–4539. doi:10.1111/j.1742-4658.2007.05982.x
Zeng X, Barros MH, Shulman T, Tzagoloff A (2008) ATP25, a new nuclear gene of Saccharomyces
cerevisiae required for expression and assembly of the Atp9p subunit of mitochondrial ATPase.
Mol Biol Cell 19:308–317. doi:10.1091/mbc.E07
Zhang Z, Huang L, Shulmeister VM et al (1998) Electron transfer by domain movement in
cytochrome bc1. Nature 392:677–684. doi:10.1038/33612
Zhu J, Egawa T, Yeh S-R et al (2007) Simultaneous reduction of iron-sulfur protein and
cytochrome b(L) during ubiquinol oxidation in cytochrome bc(1) complex. Proc Natl Acad
Sci USA 104:4864–4869. doi:10.1073/pnas.0607812104
Zickermann V, Wirth C, Nasiri H, et al (2015) Mechanistic insight from the crystal structure of
mitochondrial complex I. 5:4–10
Zollner A, R€odel G, Haid A (1992) Molecular cloning and characterization of the Saccharomyces
cerevisiae CYT2 gene encoding cytochrome-c1-heme lyase. Eur J Biochem 207:1093–1100
Bioenergetic Pathways in the Chloroplast:
Photosynthetic Electron Transfer
Philipp Gäbelein, Laura Mosebach, and Michael Hippler
Abstract In this review, we address bioenergetic pathways in the chloroplast of

Chlamydomonas reinhardtii, with a focus on photosynthetic electron transfer. The
conversion of solar energy into chemical energy by oxygenic photosynthesis, as
performed by plants, green algae and cyanobacteria, supports the life on this planet.
The production of oxygen (O2) and the assimilation of carbon dioxide (CO2) into
organic matter determine, to a large extent, the composition of our atmosphere. Plant
photosynthesis is conducted by a series of reactions that occur mainly in the
chloroplast, resulting in light-dependent H2O oxidation, NADP+ reduction and
ATP formation. NADPH and ATP, produced by linear electron flow (LEF), are
required for carbon fixation via the Calvin-Benson-Bassham (CBB) cycle. Besides,
photosynthetic electron transfer may operate in a cyclic electron flow (CEF) mode to
satisfy the cellular ATP demand. Electrons derived from LEF may also be diverted
to various other metabolic pathways, e.g. via ferredoxin (FDX). In addition, photo-
synthesis evolved to maximize its outcome while minimizing photooxidative stress.
In this regard, mechanisms such as non-photochemical quenching (NPQ) and state
transitions regulate energy influx at different light availabilities, which feedback to
the proton-motive force (pmf) and the redox state of the plastoquinone/plastoquinol
(PQ) pool, thereby also regulating LEF and CEF. To overcome possible limitations
in electron transfer at the acceptor side of photosystem (PSI), alternative electron
transfer pathways evolved, including flavodiiron proteins (FDPs), allowing safe
utilization of O2 as alternative electron acceptor, as well as the hydrogenase,
which utilizes two electrons and two protons to produce H2. Nevertheless, reactive
oxygen species (ROS) may be formed, e.g. via the Mehler reaction at the acceptor
side of PSI, which is why photosynthetic electrons are also utilized in detoxification
mechanisms to prevent excessive damage. In conclusion, photosynthetic electron
transfer is interwoven in a regulatory network that is aimed at adjusting ATP and
NADPH production in a way that electron transfer is not harmful to the cell.
Authors Philipp Gäbelein and Laura Mosebach contributed equally to the work.
P. Gäbelein • L. Mosebach • M. Hippler (*)

Institute of Plant Biology and Biotechnology, University of Münster, Schlossplatz 8, 48143
Münster, Germany

98 P. Gäbelein et al.
1 LEF Operation
The photosynthetic machinery, which resides in the thylakoid membrane of the

chloroplast, comprises transmembrane protein complexes as the two photosystems
(PS) II and I with their light-harvesting complexes (LHC) and the cytochrome b6f
complex (Cyt b6f complex), together harbouring the essential components medi-
ating light-induced charge separation and subsequent electron transfer along with
proton translocation. The chloroplast CF1-F0-ATP-synthase (ATPase), another
integral protein complex, transforms energy stored in the form of an electrochem-
ical gradient into biologically useful free energy (Mitchell 1961). These major
protein complexes are distributed across the thylakoid membrane in a heteroge-
neous way, with PSII and the Cyt b6f being localized in the stacked domains, the
Cyt b6f and PSI coinciding at the intermediate areas and the Cyt b6f, PSI and the
ATPase residing in the unstacked regions. Still, thylakoid stacking is less
pronounced in the C. reinhardtii chloroplast compared to vascular plants (see
chapter “Thylakoid Ultrastructure: Visualizing the Photosynthetic Machinery”).
Furthermore, the photosynthetic apparatus features peripheral protein complexes,
such as the ferredoxin:NADP+ oxidoreductase (FNR) and the mobile electron
carriers plastoquinone/plastoquinol (PQ/PQH2), plastocyanin (PC), cytochrome
c6 and ferredoxin (FDX), all being involved in photosynthetic electron transfer
(Nelson and Ben-Shem 2004; Nelson and Yocum 2006).
1.1 PSII and PSI
Light energy absorbed by the photosynthetic pigments of LHC antenna proteins is

transmitted to the reaction centre subunits of PSII and PSI via energy resonance
transfer. C. reinhardtii features four major trimeric LHCII proteins (type I–IV,
encoded by LhcbM3, LhcbM4, LhcbM6, LhcbM8 and LhcbM9; LhcbM5; LhcbM2
and LhcbM7; and LhcbM1, respectively) as well as two minor monomeric LHCII
proteins (CP29 and CP26, encoded by Lhcb4 and Lhcb5, respectively), contributing
to the formation of PSII-LHCII supercomplexes with three LHCII trimers attached
to both sides of the dimeric core (C2S2M2L2) (Tokutsu et al. 2012; Drop et al.
2014a). In contrast, nine LHCI proteins (encoded by Lhca1–Lhca9) constitute a
double-layered, heterogeneous belt associated with one side of the monomeric PSI
core (Drop et al. 2011). At the reaction centres, where the special chlorophyll
a pairs P680 (PSII) and P700 (PSI) represent the primary electron donors, photo-
chemical charge separation occurs: At P680, excited electrons are transferred
towards a tightly bound PQ at the QA site via the primary electron acceptor
pheophytine. From the loosely bound PQ at the QB site, electrons enter the PQ
pool by successive PQ reduction during two photochemical cycles, involving the
uptake of protons from the thylakoid stroma. The resulting electron gap at P680+
Bioenergetic Pathways in the Chloroplast: Photosynthetic Electron Transfer 99
provides a redox potential sufficient to oxidize H2O, giving rise to O2 evolution,

which is accompanied by the release of protons to the thylakoid lumen. This process
is mediated by a manganese cluster (Mn4CaO5) at the luminal side, serving as a
charge accumulator passing through five intermediate states (S0–S4) and thereby
connecting the four electron oxidation of two H2O via tyrosine YZ of the D1 subunit
with the one electron event at P680 (Vinyard et al. 2013). At PSI, light-induced
excitation of P700 facilitates electron donation to one of two primary acceptors
chlorophyll a A0. Subsequently, electrons are transmitted towards the stromal side
along two parallel branches via phylloquinone A1, rejoining at the [4Fe-4S] clusters
FX, FA and FB, where the reduction of the [2Fe-2S] electron carrier FDX occurs.
Completing the process of LEF, electrons are successively transferred within a
ternary complex from FDX to NADP+ via the FAD-containing enzyme FNR,
consuming one proton per NADPH (Kurisu et al. 2001). The resulting reducing
equivalents facilitate assimilatory pathways, in particular the Calvin-Benson-
Bassham (CBB) cycle, which involves CO2 fixation.
Electron transfer between FDX1 and PSI depends on protein-protein interactions
between the subunits PsaC, PsaD and PsaE (Busch and Hippler 2011). P700+ in turn
is reduced via PC, a copper-containing electron carrier at the luminal side of the
thylakoid membrane. For electron transfer between PC and PSI, a detailed protein-
protein interaction model has been depicted by Sommer et al. (2004). Herein,
efficient electron transfer between PC and PSI is dependent on hydrophobic as
well as electrostatic interactions [see also Busch and Hippler (2011)]. Long range
electrostatic attractions between basic patches of PsaF and acidic regions of PC
(Nordling et al. 1991; Haehnel et al. 1994; Hippler et al. 1996, 1997, 1998) as well
as hydrophobic contact between the electron transfer site of the donors and of PSI
including PsaA-W651 and PsaB-W627 in C. reinhardtii (Haehnel et al. 1994;
Sommer et al. 2002) are required for stable electron transfer complex formation
and efficient electron transfer. Mutations of PsaB-Glu613 to Asn or PsaB-Asp612
and PsaB-Glu613 to His result in a clear acceleration of electron transfer rates and
improved binding of PC to PSI in comparison to wild type (Sommer et al. 2002;
Kuhlgert et al. 2012). Structural data clearly show that the negative charge provided
by PsaB-Glu613 is exposed on the surface of PSI (Ben-Shem et al. 2003). Thus, it is
possible that a change of Asp/Glu to Asn/His results in tighter binding of the donor
to PSI, since this mutation decreases the electrostatic repulsion between the nega-
tively charged donors and PSI, which in turn might result in slower unbinding of
oxidized PC (Finazzi et al. 2005), leading to slower electron transfer between PSI
and the Cyt b6f complex.
1.2 Cyt b6f Complex
Being functionally interposed between PSII and PSI in LEF, the homodimeric Cyt
b6f complex pursues the photosynthetic electron transport chain at the level of the
PQ pool via successive PQH2 oxidation at the Qo site, involving the release of
protons into the thylakoid lumen. Subsequently, electrons follow two bifurcating
routes: either they pass through the high potential chain starting from the [2Fe-2S]
centre of the Rieske subunit via heme c at Cyt f to finally reduce PC or they return to
the PQ pool joining a modified Q-cycle via the Cyt b6 low potential chain from
heme bl over heme bh to the Qi site, where successive PQ reduction occurs,
including the uptake of protons from the thylakoid stroma. In addition, a heme ci
on the stromal face near the Qi site has been described, although its function is
elusive so far (Kurisu et al. 2003; Stroebel et al. 2003; Baniulis et al. 2008).
1.3 Transmembrane Electrochemical Proton Gradient
Besides supplying NADPH for downstream metabolic reactions, LEF contributes to

the generation of a transmembrane electrochemical proton gradient: Via H2O
splitting at PSII, four protons per two molecules H2O are released into the lumen.
At the level of the Cyt b6f complex, Q-cycle operation facilitates proton transloca-
tion from the stromal to the luminal side of the thylakoid membrane with an
efficiency of two protons per electron. NADPH production consumes one proton
per molecule in the stroma. In the end, three protons are translocated across the
thylakoid membrane per electron passing through the electron transport chain. The
resulting proton-motive force (pmf) is utilized by the ATPase to produce ATP.
Moreover, the electric component (ΔΨ) of the pmf impacts the ATPase activity,
which is further regulated via thiol modulation by the chloroplast thioredoxin
(TRX) system.
As the C. reinhardtii CF0 subunit of the ATPase features a 13-fold rotational
symmetry, the pmf promotes the synthesis of 1.38 ATP per NADPH (Meyer Zu
Tittingdorf et al. 2004; Alric 2010). However, the CBB cycle demands a ratio of
3 ATP per 2 NADPH. This demand is further increased to 4 ATP per 2 NADPH,
when the carbon-concentrating mechanism (CCM) is active under ambient CO2
conditions in C. reinhardtii (Lucker and Kramer 2013). Diverse auxiliary electron
flow pathways compensating for this ATP deficit will be discussed in the subse-
quent sections.
2 LEF Regulation
C. reinhardtii is exposed to fluctuating light intensities and varying nutrient avail-

abilities, so that a fine-tuned regulation of light harvesting and subsequent electron
transfer processes via feedback loops is essential to balance energy provision and
energy consumption in a tightrope walk between optimally satisfying the demands
of downstream metabolic reactions on the one hand and protecting the organism
from photodamage on the other hand. Singlet-excited chlorophylls decay to the
ground state via various potential routes: fluorescence emission, energy resonance
transfer at the antenna, photochemical quenching at the reaction centres,

non-photochemical quenching (NPQ) and relaxation via the triplet-excited state
promoting the formation of singlet oxygen (1O2) (Müller et al. 2001). NPQ of PSII
chlorophyll fluorescence may be differentiated into three distinct components based
on their relaxation kinetics (Baker 2008): (1) energy-dependent quenching (qE),
i.e. thermal energy dissipation; (2) state transition-related quenching (qT),
i.e. redistribution of incident excitation flux between the two photosystems; and
(3) irreversible photoinhibition-associated quenching (qI).
2.1 State Transitions
In C. reinhardtii, state transitions and thermal energy dissipation play complemen-

tary roles: At low light intensities, balancing the relative absorption cross-sections
of the photosystems is integral to sustain photosynthetic electron transfer. Further-
more, in C. reinhardtii, the initial part of glycolysis and the degradation of starch
are localized in the chloroplast (Terashima et al. 2010, 2011; Johnson and Alric
2012), and the habitat of C. reinhardtii is prone to hypoxia or anoxia, resulting in
amplified reduction of the PQ pool via light-independent reactions (Yang et al.
2015a). The redox state of the PQ pool, sensed at the Qo site of the Cyt b6f complex
(Zito et al. 1999), controls the activity of the serine-threonine kinase Stt7 (Depège
et al. 2003), which is presumably also regulated via a trans-thylakoid thiol-reducing
pathway mediated by the chloroplast TRX system (Lemeille et al. 2009). Alterna-
tively, reduction of Stt7 might occur via superoxide (O2• ), known to be generated
at the Cyt b6f complex by PQH2 oxidation (Singh et al. 2016). Stt7 reversibly
phosphorylates LHCII proteins, ensuing the lateral migration of phosphorylated
LHCIIs from PSII to PSI (Rochaix 2014; Goldschmidt-Clermont and Bassi 2015).
This equilibrates the redox state of the PQ pool, alleviating the reduction pressure
exerted by PSII and enhancing the oxidation pressure arising from PSI photochem-
istry (Delosme et al. 1996). Strictly speaking, the resulting chlorophyll fluorescence
quenching at PSII is not of a non-photochemical nature in this case but rather occurs
in a photochemical way at the reaction centre of PSI. This concept has been
challenged by several recent studies (Iwai et al. 2010b; Nagy et al. 2014; Ünlü
et al. 2014, 2015), which proposed phosphorylated LHCII antenna disconnected
from PSII to form non-photochemically quenching aggregates. Yet, another current
study (Nawrocki et al. 2016) substantiates the established concept and concludes,
based on in vivo absorption spectroscopy in agreement with structural (Drop et al.
2014b) and biochemical data (Takahashi et al. 2014), that upon state transitions
either two LHCII trimers and one monomeric antenna protein, or two type II LHC
trimers, two CP29 and one CP26 associate with the PSI core. From a physiological
point of view, state transition has been demonstrated to play a critical role in the
acclimation to anoxic conditions or high-light stress (Cardol et al. 2009; Bergner
et al. 2015).
2.2 qE-Dependent NPQ
In contrast to qT, the capacity to dissipate excitation energy as heat is not always
present in C. reinhardtii [opposed to the situation in vascular plants, where
qE-dependent NPQ is constitutive (Rochaix 2014; Wobbe et al. 2015)], but largely
depends on the availability of LHCSR3 (Peers et al. 2009). LHCSR3 expression is
induced in response to environmental conditions promoting photooxidative stress,
i.e. high light, being sensed by a blue light photoreceptor (Petroutsos et al. 2016).
In addition, LHCSR3 expression is induced in response to low CO2 availability,
requires functional photosynthetic electron transfer and is regulated via Ca2+ and
the Ca2+ sensor CAS (Petroutsos et al. 2011; Maruyama et al. 2014; Wang et al.
2016). Binding of LHCSR3 to the PSII-LHCII supercomplex is facilitated by the
PSII subunit R (PSBR) (Xue et al. 2014). The resulting PSII-LHCII-LHCSR3
supercomplex is proposed to exist in two distinct states: the light-harvesting state
and the photoprotective state. A transition from the high fluorescent to the energy
dissipative state is triggered by the protonation of LHCSR3 (Liguori et al. 2013;
Tokutsu and Minagawa 2013; Ballottari et al. 2016). Until lately, it had been
established that the luminal pH sensor PSII subunit S (PsbS), being essential for
qE-dependent NPQ induction in land plants (Li et al. 2000, 2004; Fan et al. 2015),
played no role in C. reinhardtii, as the PsbS gene product was not detected under a
wide range of growth conditions (Bonente et al. 2008). Recent studies however
revisited the biological function of PsbS in C. reinhardtii, reporting a rapid but
transient accumulation of PsbS in response to high-light stress (Correa-Galvis et al.
2016; Tibiletti et al. 2016). Importantly, a knockdown of PsbS resulted in dimin-
ished NPQ capacity and LHCSR3 accumulation, implicating that LHCSR3-
dependent NPQ in C. reinhardtii partially depends on the presence of PsbS
(Correa-Galvis et al. 2016). Intriguingly, PsbS expression is induced in response
to UV-B light via the photoreceptor UVR8 and acclimation to UV-B light primes
C. reinhardtii for photoprotection during subsequent high-light stress (Allorent
et al. 2016).
The induction of qE-dependent NPQ is tightly coupled to the osmotic compo-
nent of the pmf (ΔpH) and hence creates a regulatory feedback loop between
electron transfer and light harvesting: Once the excitation flux exceeds the capacity
of downstream metabolic reactions, the arising acidification of the thylakoid lumen
initiates a downregulation of PSII photochemistry, thereby alleviating the reducing
pressure exerted on downstream components of the photosynthetic electron trans-
port chain (Kramer et al. 2004a). State transitions and qE-dependent NPQ play
complementary roles in the acclimation to high-light stress in C. reinhardtii
(Allorent et al. 2013).
2.3 Photosynthetic Control
Furthermore, intensified acidification of the thylakoid lumen provokes the release

of Ca2+ from the H2O-splitting complex, thereby inactivating O2 evolution
(Hochmal et al. 2015). Besides regulating the activity of PSII, the ΔpH controls
the rate-limiting step of LEF, i.e. the oxidation of PQH2 at the Qo site (Stiehl and
Witt 1969; Finazzi and Rappaport 1998; Rott et al. 2011). Alternatively, it has been
proposed that the activity of the Cyt b6f complex might be regulated in response to
the stromal redox poise via a TRX-mediated mechanism (Johnson 2003). As the
induction of qE-dependent NPQ is delayed in C. reinhardtii, shifting the rate-
limiting step of photosynthetic electron transfer from the PSI acceptor side to the
Cyt b6f complex is critical, in particular for the short-term acclimation to high-light
stress (Chaux et al. 2015). The decrease in lumenal pH might also diminish the rate
of electron transfer between the oxidizing side of PSI and the Cyt b6f complex, as
PC binds tighter to PSI and unbinds slower at lower pH (see Sect. 1.1), thereby
additionally contributing to the avoidance of PSI acceptor side limitation. A
secondary effect of constraining the rate of photosynthetic electron transfer at the
Cyt b6f complex (termed “photosynthetic control”) is an enhanced back pressure on
PSII at the level of the PQ pool, which provokes PSII photoinhibition: Relaxation of
singlet-excited P680 via the triplet-excited state promotes the formation of 1O2
irreversibly damaging the D1 subunit and thereby inactivating the PSII reaction
centre. Since the high turnover rate of the D1 protein facilitates a fast recovery of
PSII from photooxidative damage, it is considered as “predetermined breaking
point” of the electron transport chain, being essential for the protection of down-
stream components (Sonoike 2011; Murata et al. 2012; Järvi et al. 2015). In
C. reinhardtii, integral components involved in D1 turnover are the
ATP-dependent zinc metalloprotease FtsH1, which degrades damaged D1 frag-
ments (Malnoë et al. 2014) and TEF30, contributing to PSII repair (Muranaka et al.
2016).
2.4 Pmf Partitioning
As introduced in the preceding paragraphs, the transmembrane proton gradient

induces photoprotective mechanisms, i.e. qE-dependent NPQ and photosynthetic
control. Still, excessive lumenal acidification results in PSII inactivation (Krieger
and Weis 1993). Likewise, as reported lately, an elevated electric field component
of the pmf induces PSII photodamage (Davis et al. 2016). Therefore, a tight
regulation of pmf partitioning is essential. Recently, the critical role of pmf
partitioning modulation via counter ion fluxes balancing proton fluxes has been
demonstrated in vascular plants: A Ca2+-dependent two-pore K+ efflux channel
(TPK3), a K+/H+ antiport (KEA3) and Cl channels (voltage-dependent
AtVCCN1/AtBest and AtCLCe) have been established as integral players being
involved in this mechanism and thereby sustaining photosynthetic efficiency

(Carraretto et al. 2013; Armbruster et al. 2014, 2016; Kunz et al. 2014; Duan
et al. 2016; Herdean et al. 2016a, b). Although in C. reinhardtii, such ion channels
have not been described yet, pmf partitioning modulation constitutes another
potential mechanism impacting the ΔpH component of the pmf and thereby regu-
lating ATP synthesis, photosynthetic electron transfer and light harvesting.
As mentioned in this section, LEF alone is not sufficient to equilibrate the ATP
to NADPH ratio. Diverse auxiliary electron flow pathways, addressed in the
subsequent sections, sustain the redox homeostasis of the chloroplast and contribute
to the transmembrane photochemical proton gradient, having been introduced as
essential regulatory photoprotective component in this section.
3 CEF Operation
Starting from NADPH or reduced FDX, electrons may be recycled to a component

of the photosynthetic electron transport chain upstream of PSI, thereby completing a
cycle around PSI. CEF around PSI operates via two distinct pathways:
NDH-dependent and FQR-dependent CEF (Eberhard et al. 2008; Alric 2010; Cardol
et al. 2011). The physiological significance of CEF has emerged over the last decade,
not least via investigation of the PGR5 (proton gradient regulation 5)/PGRL1
(PGR5-like photosynthetic phenotype 1) knockout mutants. The recycling of elec-
trons via CEF around PSI creates a regulatory feedback loop between the stroma and
upstream components of the photosynthetic electron transport chain and contributes
to the transmembrane electrochemical proton gradient. Hence, CEF sustains the
redox poise of the photosynthetic electron transport chain and is involved in the
equilibration of the ATP to NADPH ratio (Kramer et al. 2004a; Alric 2010). Since
the habitat of C. reinhardtii is prone to hypoxia/anoxia, CEF and H2 production play
an essential role as electron sinks alleviating enhanced stromal redox pressure and
sustaining photosynthetic CO2 fixation (Hemschemeier and Happe 2011; Ghysels
et al. 2013; Clowez et al. 2015; Godaux et al. 2015) (see chapters “Chlamydomonas:
Anoxic Acclimation and Signaling” and “Chlamydomonas: Hydrogenase and
Hydrogen Production”). FQR-dependent CEF, often related to as PGRL1/PGR5-
dependent CEF, has been reported to be the major CEF pathway in anoxic conditions
in C. reinhardtii (Alric 2014). To what extent CEF is directly responsible for the
onset of photosynthetic control and the induction of qE-dependent NPQ via acidi-
fication of the thylakoid lumen is an issue of controversy: While both LEF and CEF
modulate proton influx, proton efflux is mediated by the ATPase. Therefore, mech-
anisms regulating the ATPase conductivity (gH+), potentially via stromal Pi levels,
have been proposed to account for the initiation of these photoprotective mecha-
nisms as well (Johnson 2004; Kramer et al. 2004b).
3.1 NDH-Dependent CEF
In C. reinhardtii, a type II-NDH complex (Nda2) accounts for NDH-dependent

CEF, i.e. the light-dependent non-photochemical reduction of PQ (Mus et al. 2005;
Jans et al. 2008). Nda2 is non-electrogenic and anchored to the stromal side of the
thylakoid membrane. It features two Rossmann-fold domains (β-sheet–-
α-helix–β-sheet): one binding the FMN cofactor and the other binding NADP(H).
In vitro, recombinant Nda2 mediates the reduction of PQ with NADH as preferen-
tial substrate (Desplats et al. 2009; Peltier et al. 2016). In vivo, the
transhydrogenase may convert NADPH, the predominant reducing equivalent in
the chloroplast, to NADH, being favoured by Nda2 (Terashima et al. 2010).
Harbouring two EF hands, Nda2 activity is potentially regulated via Ca2+ (Hochmal
et al. 2015). Furthermore, Nda2 is subjected to posttranslational modifications in
the form of phosphorylations (Wagner et al. 2007). Besides mediating
NDH-dependent CEF, Nda2 facilitates the light-independent reduction of PQ,
constituting the initial part of chlororespiration (see Sect. 5.2). This pathway creates
a light-independent feedback loop between the stromal redox poise and the PQ pool
redox state and thus potentially predetermines the balance of light harvesting by
state transitions and the partitioning of photosynthetic electron transfer at the onset
of illumination by poising of intersystem electron carriers (Nawrocki et al. 2014).
Recently, chlororespiration has been proposed to be critical for the adjustment of
the intracellular N/C ratio in response to N2 deprivation (Wei et al. 2014; Saroussi
et al. 2016). Furthermore, Nda2 provides access to NAD(P)H derived from endog-
enous carbon sources, which is, for instance, essential for sustained PSII-
independent H2 photoproduction (Grossman et al. 2011; Baltz et al. 2014) (see
chapter “Chlamydomonas: Hydrogenase and Hydrogen Production”).
3.2 FQR-Dependent CEF
While NDH-dependent CEF in C. reinhardtii relies on NAD(P)H as electron source

[in contrast to vascular plants, where FDX is the electron donor of an electrogenic
type I-NDH multisubunit complex (NDH1) being associated with PSI (Peng et al.
2008; Yamamoto et al. 2011; Peltier et al. 2016)], FQR-dependent CEF involves
the FDX-dependent reduction of PQ. The precise molecular mechanism of
FQR-dependent CEF, at least in C. reinhardtii, is still elusive, as there is no definite
evidence which component supplies the required FQR activity. In this context, it
has been proposed in vascular plants that upon association of FNR with the Cyt b6f
complex (Clark et al. 1984; Zhang et al. 2001), PQ might be reduced at the Qi site
according to a modified Q-cycle process involving concerted electron transfer from
FDX or FNR, potentially via heme ci, and from heme bh to PQ (Joliot and Joliot
2006; Baniulis et al. 2008; Johnson 2011). However, PGR5 and PGRL1 have been
identified as factors impacting FQR-dependent CEF efficiency. PGR5 is associated
with the stromal side of the thylakoid membrane and likely positively charged
under physiological conditions (Munekage et al. 2002). PGRL1 exhibits two
transmembrane domains and features a negatively charged N-terminal loop,
which presumably interacts with the positively charged regions of PGR5, resulting
in heterodimerization. Furthermore, PGRL1 forms homodimers being destabilized
in the presence of TRX. Accumulation of PGR5 requires the presence of PGRL1,
whereas PGR5 promotes PGRL1 stability. (DalCorso et al. 2008). Furthermore,
PGRL1 performs iron-dependent redox-induced conformational changes and fea-
tures six redox-active cysteine residues, which mediate diverse intra- and
intermolecular interactions via thiol-disulphide transitions (Petroutsos et al. 2009;
Hertle et al. 2013). Four of these cysteines form a rubredoxin-fold, which may
facilitate the binding of an iron-containing cofactor (Petroutsos et al. 2009). The
four cysteines potentially involved in the binding of this cofactor are also required
for heterodimerization (Hertle et al. 2013). Copurification implicates the PGRL1-
PGR5 complex associates with PSI. Moreover, split-ubiquitin and yeast two-hybrid
assays revealed that PGRL1 interacts with FDX and FNR, whereas both PGRL1
and PGR5 interact with the Cyt b6f complex, as confirmed by
co-immunoprecipitation assays (DalCorso et al. 2008; Hertle et al. 2013). In
addition, BiFC studies demonstrated PGRL1 interacts with ANR1 and CAS
(Terashima et al. 2012). Leister and his group demonstrated in vitro that PGRL1
exhibits the required features of an FQR: PGRL1 accepts electrons from FDX in a
PGR5-dependent way and donates electrons to PQ. The redox-dependent interac-
tion of PGRL1 with PGR5 may induce a conformational change enabling electron
transfer from FDX to PGRL1 (Hertle et al. 2013). However, in C. reinhardtii
mechanistic evidence is lacking that PGRL1 in fact acts as FQR in vivo. While
on the molecular level, the function of PGRL1 and PGR5 is elusive, the phenotype
of PGRL1/PGR5 knockout mutants has been studied in detail.
The photosynthetic phenotype of C. reinhardtii PGR5 and/or PGRL1 knockout
mutants strongly resembles the one described for A. thaliana (Munekage et al.
2002, 2004; Nandha et al. 2007; DalCorso et al. 2008; Suorsa et al. 2012): Both
pgrl1 and pgr5 fail to induce qE-dependent NPQ in response to high light (Tolleter
et al. 2011; Johnson et al. 2014) and FQR-dependent CEF in anoxia, where both the
stroma and the PQ pool tend to be reduced (Tolleter et al. 2011; Alric 2014; Johnson
et al. 2014; Godaux et al. 2015). Likewise, both mutants feature diminished electron
transfer rates (Petroutsos et al. 2009; Dang et al. 2014; Johnson et al. 2014) and are
extremely susceptible to PSI photodamage in response to high light (Johnson et al.
2014; Kukuczka et al. 2014). Both the deficient induction of qE-dependent NPQ
and the enhanced PSI photoinhibition related to impaired photosynthetic control
likely arise from insufficient acidification of the thylakoid lumen, i.e. perturbation
of the regulatory feedback loop linking metabolic capacity and excitation flux. This
lost capability to fine-tune the transmembrane proton gradient may arise from
reduced proton influx and/or enhanced proton efflux. In fact, in vivo ECS absorp-
tion spectroscopy indicated, in response to high light, the pmf in A. thaliana pgr5 is
diminished due to an increased gH+ of the ATPase (Avenson et al. 2005; Wang et al.
2015). Such alterations of the ATPase conductivity imply a potential direct
involvement of PGR5 in mechanisms regulating the ATPase (Tikkanen et al. 2015).

Otherwise, the ATP deficit resulting from reduced CEF efficiency entails the
accumulation of Pi in the thylakoid stroma, which in turn may increase gH+ (Kramer
et al. 2004a). The fact that low CO2 conditions restore the ability of pgr5 plants to
induce qE-dependent NPQ (Nandha et al. 2007; Munekage et al. 2008) corroborate
this notion, as the reduced assimilatory capacity results in decreased ATP consump-
tion. Another interesting insight was obtained with the ATPase PGR5 double
mutant in C. reinhardtii: The high-light-sensitive phenotype arising from over-
acidification of the thylakoid lumen in the ATPase single mutant is alleviated in
ΔATPase pgr5. Likewise, electron transfer is restored, as the additional absence of
PGR5 in the double mutant mitigates the intense photosynthetic control in the
ATPase single mutant. Both findings confirm the perturbation of the transmembrane
proton gradient in the PGR5 single mutant and point to an impact on proton influx as
opposed to proton efflux via the ATPase (Johnson et al. 2014). Recent reports even
indicate a surprisingly high contribution of ΔpH (relative to ΔΨ) to the reduced
total pmf in A. thaliana pgr5, suggesting the existence of a yet unknown compen-
satory mechanism, still failing to trigger qE-dependent NPQ and photosynthetic
control in this mutant (Shikanai and Yamamoto 2016; Yamamoto et al. 2016).
Another intriguing aspect of potential PGRL1 functions has been revealed investi-
gating the acclimation of a PGRL1 knockdown mutant to iron deficiency, a condi-
tion where both PGR5 and PGRL1 expression are induced in the wild type. In this
mutant, the response to iron deprivation is perturbed: The ATP deficit arising from
the impaired induction of FQR-dependent CEF is compensated by enhanced respi-
ration. However, the augmented mitochondrial activity potentially results in inten-
sified iron redistribution to sustain the activity of respiratory complexes, resulting in
reduced photosynthetic activity. Moreover, the PGRL1 knockdown mutant features
iron deficiency symptoms at higher iron concentrations than the wild type. There-
fore, the authors proposed PGRL1 plays a dual role in both iron sensing/redistri-
bution and electron transfer partitioning (Petroutsos et al. 2009). Similar to the
phenomenon observed during iron starvation, further compensatory mechanisms
are induced to cope with the reducing power accumulating at the PSI acceptor side
in the absence of PGR5 and/or PGRL1: In pgrl1 an increased cooperation between
chloroplast and mitochondria was observed, facilitating a dissipation of excess
reducing power in the mitochondria (Petroutsos et al. 2009; Tolleter et al. 2011;
Dang et al. 2014). In addition, the expression of flavodiiron NAD(P)H:O2 oxido-
reductases (FLVA/B) is enhanced in pgrl1 in response to high-light and low-CO2
conditions (Dang et al. 2014). In line with this finding, overexpression of
Physcomitrella patens FLVA and FLVB abolishes PSI acceptor side limitation in
A. thaliana pgr5 plants (Yamamoto et al. 2016). Finally, pgr5, pgrl1 and pgr5pgrl1
feature enhanced H2 production in short-term and long-term anoxia/sulphur depri-
vation (Tolleter et al. 2011; Godaux et al. 2015; Steinbeck et al. 2015; Chen et al.
2016). Addition of the uncoupling agent FCCP elevates H2 production in the wild
type to a similar level as in pgrl1, reflecting the perturbation of the transmembrane
proton gradient in the mutant (Tolleter et al. 2011). An accelerated transition to
anoxia and efficient O2 consumption due to increased mitochondrial respiration and
enhanced ROS-scavenging enzyme activity in the mutants during sulphur depriva-

tion even sustains the activity of PSII, since it is more efficiently protected from
photodamage (Steinbeck et al. 2015; Chen et al. 2016).
4 CEF Regulation
Emerging concepts for the regulation of CEF, in particular in relation to LEF, range
from a dynamic competition between electron flow pathways to a structural and
thermodynamic segregation (Eberhard et al. 2008). In a freely diffusing system,
reaction kinetics have to be considered. While the rate-limiting step of LEF is the
oxidation of PQH2 at the Qo site of the Cyt b6f complex, the reduction of PQ has
been considered as the rate-limiting step of CEF, since LEF and CEF compete at
this point (Alric 2010). Furthermore, the stromal redox poise and in particular the
redox state of the NADP+/NADPH pool have been proposed to modulate CEF
operation relative to LEF activity (Hald et al. 2008; Alric et al. 2010; Johnson
2011). In addition, FNR and reduced FDX may play an essential role in electron
flow partitioning (Breyton et al. 2006; Goss and Hanke 2014). As LEF and CEF
coincide at various points but compete at others, a varying extent of spatial
separation has been predicted. In vascular plants, which feature extensive lateral
heterogeneity, restricted diffusion of PQ in compartmentalized pools may confine
CEF to unstacked areas, whereas LEF might predominate in stacked regions
(Kirchhoff 2014). Since in C. reinhardtii, lateral heterogeneity is not as pronounced
as in vascular plants, further concepts suggesting the formation of multiprotein
complexes directing electrons towards distinct routes might be more relevant in this
context. According to the FNR model, the association of FNR with PSI (or soluble
FNR in the thylakoid stroma) might promote LEF, whereas following the associ-
ation of FNR with the Cyt b6f complex, CEF may operate preferentially (Joliot and
Joliot 2006; Johnson 2011; Goss and Hanke 2014). A potential CEF supercomplex
has been isolated from C. reinhardtii upon sucrose density gradient centrifugation
of solubilized thylakoids (Iwai et al. 2010a; Terashima et al. 2012). In vascular
plants, such a multiprotein complex remained elusive (Breyton et al. 2006), until it
has been identified in a recent electron microscopy-based study (Yadav et al. 2017).
The formation of the putative CEF supercomplex in C. reinhardtii is induced in
response to alterations of the chloroplast redox poise as upon shifts to anoxia or
high light (Takahashi et al. 2013; Bergner et al. 2015), i.e. reducing conditions
where CEF is induced to dissipate stromal redox pressure (Alric 2014). The
multiprotein complex comprises major components of the electron transport
chain such as the Cyt b6f complex, PSI and FNR, both LHCI and LHCII as well
as PGRL1, PETO (Iwai et al. 2010a; Takahashi et al. 2013), PGR5 (unpublished
data), ANR1 and CAS (Terashima et al. 2012). Knockdown of PETO, ANR1
and CAS results in impaired CEF induction upon a shift to anoxia, as well as in
high-light sensitivity in the case of ANR1 and CAS (Terashima et al. 2012;
Takahashi et al. 2016). Association of the Ca2+-sensor CAS with the putative CEF
supercomplex points to a Ca2+-dependent regulation of FQR-dependent CEF in
C. reinhardtii (Terashima et al. 2012; Chen et al. 2015).
5 Auxiliary Electron Transport Pathways
In addition to the “classical” linear and cyclic electron transport pathways, there
exists a multitude of pathways which are all more or less directly interconnected
with the regulation and function of the major photosynthetic complexes. These
“auxiliary” pathways are mainly thought to optimize photosynthetic function as
well as ensure continued operation of the system in an ever-changing environment.
Accordingly, the processes discussed in the following sections are most prominent
when organisms experience harsh growth conditions.
5.1 Ferredoxins
FDX is a small, soluble, [2Fe-2S]-type iron-sulphur cluster-bearing protein located

in the chloroplast stroma. In LEF, it functions as the major electron acceptor of PSI,
transferring electrons to FNR for NADPH synthesis (see Sect. 1.1). However, FDX
is also involved as electron mediator in a wide variety of metabolic pathways other
than LEF, most of which are dependent on electrons derived from the electron
transport chain. Specific distribution of photosynthesis-derived electrons between
the various metabolic pathways is thought to be achieved by the presence of
different pathway-specific FDX isoforms. Consistent with this hypothesis, 13 poten-
tial FDX isoforms are encoded in the genome of C. reinhardtii (Yang et al. 2015b),
with 11 of these being predicted to be targeted to the chloroplast. Out of these, six
isoforms have been studied in more detail (FDX1–FDX6) so far. Phylogenetic
analysis places FDX1 and FDX5 close to the photosynthetically active, so called
leaf-type FDXs and FDX2 close to the non-photosynthetic root-type FDXs of
vascular plants (Terauchi et al. 2009). FDX3, FDX4 and FDX6 seem to be more
evolutionary divergent, as they cluster with neither of the two groups and are
therefore further referred to as microbial-type FDXs.
FDX1 is the by far most abundant isoform under standard growth conditions,
where FDX1 mRNA constitutes 98% of the FDX transcript pool. This amount is
subjected to changes depending on the environmental conditions, with copper
deficiency representing the condition triggering the most dramatic changes so far,
under which the FDX1 transcript amount still accounts for 50% of the pool
(Terauchi et al. 2009). Being the most abundant, it is not surprising that this isoform
is also the one which is thought to be the most diverse in terms of its involvement in
different metabolic pathways. Its most prominent function is the support of photo-
synthetic electron flow, provided by its efficient interaction with FNR and also
hydrogenase, which is necessary to support LEF under anaerobic conditions

(Godaux et al. 2015) (see chapter “Chlamydomonas: Hydrogenase and Hydrogen
Production”). A recent study aimed at establishing an interaction network for the
various FDX isoforms in C. reinhardtii uncovered a vast number of potential
interaction partners (Peden et al. 2013). Highlighting some results being of partic-
ular interest for this chapter, FDX1 was found to be involved in TRX signalling and
thereby in all related processes amongst which are ROS signalling, ROS detoxifi-
cation and alternative electron flow linked to the Mehler reaction (see Sect. 5.3), as
well as the regulation of carbon metabolism and redox exchange between chloro-
plast and other cellular compartments. Furthermore, a possible involvement of
FDX1 in fatty acid biosynthesis, nitrogen assimilation and fermentation was
inferred.
Although clustering with the non-photosynthetic root-type FDXs, FDX2 is
structurally highly similar to FDX1 (Boehm et al. 2015). The redox potential of
FDX2 is increased by about 70 mV compared to FDX1, narrowing the number of
potential interaction partners. Nevertheless, the two isoforms share, amongst others,
FNR and hydrogenase as targets. Regarding the interaction with hydrogenase,
in vitro assays show lower rates for electron transfer via FDX2 when compared
to FDX1 (Peden et al. 2013; Boehm et al. 2015). For electron donation from either
of the two FDX isoforms to FNR, the situation is less clear, with a report claiming
lower rates achieved by FDX2 when compared to FDX1 (Peden et al. 2013), which
is contrasted by another report claiming similar rates for both isoforms but a
markedly higher affinity of C. reinhardtii FNR for FDX2, making it the more
efficient electron donor (Boehm et al. 2015). Regarding these conflicting results,
it should be kept in mind that the amount of FDX1 present in vivo dramatically
outweighs that of FDX2 in all conditions analysed so far, so that an increased
affinity for FDX2 could represent a mean of ensuring ongoing interaction with both
isoforms if they have to compete for FNR. Further functional differences between
the two isoforms include a potential involvement of FDX2 in nitrogen assimilation
as it is a more efficient electron donor to the nitrate reductase than FDX1. ANR1, a
protein shown to be upregulated in anaerobic conditions and being involved in CEF
(Terashima et al. 2010), was identified as another potential interaction partner of
FDX2, although a direct involvement of the isoform under these conditions remains
to be shown. Interestingly, and consistent with its classification as root-type FDX,
FDX2 shows a six-times higher catalytic efficiency in accepting electrons from
FNR than FDX1, suggesting a role in non-photosynthetic metabolism (Terauchi
et al. 2009).
Although clustering with the leaf-type FDXs, FDX5 plays a major role in
photosynthesis-independent dark metabolism, more specifically in sustaining thy-
lakoid membrane identity and allowing growth of C. reinhardtii cells maintained in
darkness (Yang et al. 2015b). Together with previous results showing that FDX5 is
inefficient in electron donation to FNR or hydrogenase (Jacobs et al. 2009), a direct
involvement of this isoform in photosynthetic processes seems to be highly unlikely
at this point.
The three microbial-type FDXs are less well characterized than the isoforms
related to vascular plant FDXs, with the least information being available for
FDX6. Isoforms 3 and 4 show no function in supporting LEF, as they are inefficient
in electron donation to FNR or hydrogenase. FDX4 could however indirectly affect
the function of the electron transport chain, as glycolytic enzymes and Ch-PRX1
(see Sect. 5.3.3) have been identified as potential interaction partners (Peden et al.
2013).
5.2 Chlororespiration
Chlororespiration, defined as a respiratory process within the chloroplast oxidizing

NAD(P)H at the expense of O2 and involving changes in the redox state of the PQ
pool, was demonstrated by Pierre Bennoun as early as 1982 (Bennoun 1982).
Subsequent studies led to the identification of plastid terminal oxidase (PTOX)
(Carol et al. 1999; Wu et al. 1999), a diiron oxidase located at the stromal side of the
thylakoid membrane (Lennon et al. 2003). Sequence analysis revealed a distant
relationship with the alternative oxidase (AOX) found at the n-side of the inner
mitochondrial membrane. Single copies of the PTOX gene were reported in the
genomes of most vascular plant and cyanobacteria species. Within the taxa of red,
brown or green algae, species carrying two copies of PTOX, including
C. reinhardtii, were described. PTOX shows high affinity for PQH2 as a substrate,
utilizing the extracted electrons for the reduction of O2 to H2O (Josse et al. 2003;
Yu et al. 2014). While PTOX oxidizes the PQ pool, the pool is reduced, as discussed
above, via Nda2. A phenomenon illustrating the strong link of chlororespiration
with overall cellular metabolism is the fact that in dark incubated C. reinhardtii
cultures, the redox state of PQ is strongly dependent on the aeration of the sample.
While the PQ pool in aerated cells is estimated to be 70% oxidized (Houille-Vernes
et al. 2011), it is largely reduced when O2 is withdrawn (Bennoun 1982). An
explanation is given by considering the “Pasteur effect”, i.e. the induction of
glycolysis and starch breakdown upon ATP limitation induced through the shift
to anaerobiosis. In C. reinhardtii, the “upper half” of glycolysis is localized in the
chloroplast, leading to an increase in the stromal NADPH concentration through the
catalytic activity of the glyceraldehyde-phosphate-dehydrogenase (Terashima et al.
2011; Johnson and Alric 2012). Via the action of Nda2, this results in reduction of
the PQ pool, which additionally cannot be oxidized anymore by PTOX activity as
O2 is absent.
Chlororespiration forms an important link between chloroplast and overall
cellular metabolism, as has been recently demonstrated by a pair of studies
conducted on nitrogen-limited C. reinhardtii cultures (Wei et al. 2014; Saroussi
et al. 2016). Photoheterotrophic nitrogen starvation (in the presence of acetate as a
carbon source) leads to a progressive loss of the cell’s ability to fix carbon, which is
achieved by downregulation of Rubisco, the key enzyme of the CBB cycle, and of
the Cyt b6f complex, which is elementary for photosynthetic electron flow. Under
these conditions, the cellular content of Nda2 and PTOX2 increases together with
the chlororespiratory activity. This combined effect has been interpreted as a switch
in the function of the thylakoid membrane from a photosynthetic towards a respi-
ratory mode in an effort to maintain a balanced availability of nitrogen and carbon
resources (Wei et al. 2014).
In contrast to the situation observed for photoheterotrophic nitrogen limitation,
photoautotrophic conditions do not result in a downregulation of photosynthetic
carbon fixation. Nevertheless, PTOX and Nda2 levels as well as the
chlororespiratory activity are also found to be upregulated under these conditions
(Saroussi et al. 2016). As the photosynthetic electron transport chain is still fully
functional, the role of the chlororespiratory enzymes under these conditions can be
expanded to a more direct involvement in photosynthetic electron flow (discussed
below).
Further indications for the critical role of the chlororespiratory enzymes in
adjusting the dark state of the photosynthetic electron transport chain were given
by studies observing chlorophyll fluorescence kinetics and low-temperature fluo-
rescence spectra in a ptox mutant (Houille-Vernes et al. 2011; Takahashi et al.
2013). The ptox mutant strains exhibit an overall increased reduction of the PQ pool
in darkness, leading to an altered distribution of the mobile LHCIIs between the
photosystems, modulated through the activity of the Stt7 kinase (Depège et al.
2003): Whereas in darkness, the majority of the mobile antenna is connected to PSII
in the wild type (state I), it is connected to PSI in ptox (state II). Also, upon a
transition from darkness to light, the quantum yield of PSII is drastically lowered in
ptox due to the reduction of the PSII primary electron acceptor PQ, limiting the
efficiency of PSII. Whether these phenotypic differences are accompanied by
reduced fitness under growth conditions in which they are expected to have the
strongest impact, e.g. fluctuating light, remains to be investigated. Taken together,
these results implicate a dual role of chlororespiration in darkness, which would be
(1) a direct involvement in cellular metabolism and (2) priming dark incubated cells
to ensure a photosynthetic function appropriate to the potential onset of light. As a
complicating matter, these two tasks cannot be seen as being separate. In fact, there
seems to be a tight interconnection between overall metabolism and photosynthetic
function and regulation. For instance, the magnitude of CEF has been hypothesized
to rely upon the cellular redox state (Takahashi et al. 2013), with the
chlororespiratory enzymes being critical elements involved in such a regulatory
network.
5.2.1 Chlororespiratory Enzymes in Light-Driven Electron Transport
While there is clear experimental evidence for the role of the chlororespiratory
enzymes in dark metabolism, the presence of light-driven electron transport
enhances the complexity of the PQ pool redox state. Hence, the role of Nda2 and
especially PTOX in photosynthetic electron transport is still a matter of intense
scientific debate.
Chlororespiration in C. reinhardtii itself is contributing to the buildup of the

pmf, by removing protons from the stroma to reduce PQ, as both enzymes are
located at the stromal face of the thylakoid membrane (although no charges are
transferred across the membrane due to their specific activity). Furthermore, both
Nda2 and PTOX can be part of pmf-building pathways when cooperating with
major components of the photosynthetic electron transport chain. For Nda2, this
would be PQ reduction and subsequent oxidation by the Cyt b6f complex, coupled
to the Q-cycle in which electrons and protons are translocated by Cyt b6f complex
activity (for a review, see Baniulis et al. 2008). In the context of overall photosyn-
thetic electron transfer, taking into account PSI as the driving force behind Cyt b6f
activity as well as supplying the NADPH which is reinjected into the electron
transport chain by Nda2, this pathway constitutes one possible route of CEF around
PSI (see Sect. 3). The “other” route, depending on the proteins PGR5 and PGRL1,
is generally seen as the major CEF pathway in C. reinhardtii. However, recent
evidence suggests that under certain conditions, the bulk of CEF is actually carried
out via Nda2 (Saroussi et al. 2016).
To be engaged in an electrogenic pathway, PTOX would need to work in
conjunction with PSII, oxidizing PQH2 and thereby being involved in a “short-
circuit” water-to-water cycle. The first part of this reaction sequence would be PSII-
catalysed H2O oxidation coupled to proton release into the thylakoid lumen,
electron transfer across the membrane and PQ reduction at the stromal site of the
photosystem. PTOX would then oxidize PQH2, thereby reducing O2 and releasing
H2O into the stroma. Such a water-to-water cycle would of course be inferior to any
pathway involving the Cyt b6f complex in terms of establishment of a proton
gradient necessary for ATP synthesis as well as acidification of the lumen required
for efficient photoprotection via qE-dependent NPQ.
5.2.2 Potential PTOX Functions in Light-Driven Electron Transfer
Regardless its seeming ineffectiveness, light-driven O2 reduction by PTOX has been

shown to operate at physiological significant levels in a strain of the marine alga
Ostreococcus (Cardol et al. 2008), which has low amounts of PSI, likely resulting
from a permanent adaptation to low iron availability in its habitat. Further observa-
tions across various species show rising PTOX levels correlated with the application
of abiotic stresses like high light (Trouillard et al. 2012; Laureau et al. 2013) or high
salinity (Stepien and Johnson 2009), in line with a phylogenetic analysis illustrating
that a number of halotolerant species have undergone PTOX gene duplication
(Nawrocki et al. 2014). Consequently, a role of PTOX in stress responses, more
specifically as a “safety valve” preventing the photosynthetic electron transport
chain from over-reduction and ensuing oxidative damage by providing an additional
electron sink, has been speculated. The safety valve hypothesis is a matter of
controversial scientific debate. The major criticism arises from a closer consider-
ation of PTOX turnover rates in the context of overall light-driven electron flow. In
kinetic assays, in vivo rates spanning from 0.3 e s 1 PSII 1 in tomato plants
(Trouillard et al. 2012) to 5 e s 1 PSII 1 in C. reinhardtii (Houille-Vernes et al.

2011) have been reported, while the overall rate of steady-state photosynthesis under
saturating light is estimated to be around 150 e s 1 PSII 1 (Alric et al. 2010). The
disproportion between these rates has led to the assessment that PTOX can in fact not
act as an efficient release for electrons in the case of strong reducing pressure
(Trouillard et al. 2012; Nawrocki et al. 2014). This conclusion is supported by an
early study demonstrating that chlororespiration is outcompeted by light-driven
electron transport at the onset of illumination (Peltier et al. 1987).
Contrasting the low turnover rates estimated from in vivo spectroscopic assays,
rather high activities were reported from an in vitro analysis of the enzyme
(Yu et al. 2014), reaching up to 320 e s 1 PTOX 1. Together with the observation
that PTOX1 from C. reinhardtii overexpressed in tobacco is associated with the
thylakoid membrane in leaves exposed to high light, but not in low-light-grown
leaves (Feilke et al. 2015), a consolidating hypothesis has been proposed (Krieger-
Liszkay and Feilke 2016): In this model, PTOX associates with the thylakoid
membrane in a pH-dependent manner—high light would lead to the buildup of a
strong pH gradient across the membrane, elevating the stromal pH and thereby
triggering PTOX association and activity. In low light, the stromal pH would be
more acidic, resulting in the enzyme being soluble and therefore inactive, as it
would have no access to its substrate PQH2. The model could explain the discrep-
ancies between the in vitro and the in vivo data. However, further evidence
supporting it is needed, as in its current state it is largely based on observations in
tobacco plants overexpressing PTOX1 from C. reinhardtii, and a universality of
enzymatic characteristics cannot be taken for granted across species.
Along with the debate about the impact of PTOX on light-driven electron
transport, the safety valve hypothesis has also been questioned based on reports
demonstrating the potential of the enzyme to contribute to the generation of
cytotoxic ROS. This capability for ROS production could arise from two potential
sources, assuming a catalytic mechanism analogous to that proposed for O2 reduc-
tion by AOX (Moore et al. 2013) and taking into account evidence based on the
in vitro characterization of PTOX from Oryza sativa that both reactions in principle
can take place (Yu et al. 2014): At pH 8, a semiquinone radical would be stabilized
and trigger ROS formation, while lower pH values coinciding with a limitation of
PQH2 would lead to prolonged lifetimes of a superoxo intermediate formed at the
diiron centre, ultimately giving rise to O2• .
Initial studies focused on potential photoprotecting properties of PTOX, aiming
at increased stress tolerance by overexpression of the protein. Contrary to the
expectations, elevated PTOX levels did not increase plant fitness (Rosso et al.
2006), with overexpression of foreign PTOX isoforms in Nicotiana tabacum even
leading to enhanced photoinhibition and ROS production in plants exposed to high
light (Heyno et al. 2009; Ahmad et al. 2012; Feilke et al. 2015). Given these results,
ROS production would need to be tightly controlled when considering a differential
membrane association hypothesis for PTOX. Otherwise, the function of the enzyme
as a safety valve would be excluded by its ROS-producing characteristics. It should
be kept in mind that ROS are not anymore just seen as potentially detrimental
agents but are also known to be critically involved in signalling mechanisms

allowing, amongst other cellular responses, stress acclimation (Baxter et al. 2014).
At this point, the question about the involvement of PTOX in light-driven
photosynthetic electron transfer cannot be answered conclusively. Given the data
available at present, similar to the situation in darkness, a dual role for PTOX in
light-driven electron transfer could arise: (1) as a starting point for ROS signalling
(Nawrocki et al. 2014; Krieger-Liszkay and Feilke 2016), thereby initiating a rather
long-term acclimatory response, and (2) as a valve releasing reducing pressure from
the PQ pool in conditions where the routine electron transport pathways reach their
limit.
5.2.3 Carotenoid Biosynthesis
PTOX, originally called IMMUTANS, was identified in A. thaliana plants

exhibiting a light-dependent variegated phenotype (Carol et al. 1999; Wu et al.
1999). This variegation is thought to be caused by the involvement of the PQ pool
and PTOX in carotenoid biosynthesis. In short, the desaturation of the carotenoid
precursor phytoene by the phytoene desaturase requires PQ as electron acceptor.
Consequently, the absence of PTOX during plastid development results in a strong
reduction of the PQ pool, thereby blocking the synthesis of carotenoids (Sandmann
2009). As a result, PTOX-less plastids exposed to light experience enhanced
oxidative stress, hindering their maturation.
In green algae containing single chloroplasts, the plastids divide together with
their host cells, with each emerging cell inheriting a chloroplast with a functional
photosynthetic machinery, providing light-dependent PQH2 oxidation activity. As
carotenoid accumulation in C. reinhardtii corresponds with the onset of illumina-
tion when grown in a 12-h light-12-h dark photoperiod (Janero and Barrnett 1982),
the impact of PTOX on carotenoid synthesis is expected to be minor (Nawrocki
et al. 2014). Indeed, a knockout of PTOX2 does not yield a difference in carotenoid
accumulation. On the other hand, ptox2 mutants do not even show a carotenoid
phenotype if grown under heterotrophic conditions in darkness. The presence of
PTOX1, the second isoform in C. reinhardtii, has been speculated to provide
sufficient PQH2 oxidation for driving carotenoid synthesis under these conditions
in the mutant (Houille-Vernes et al. 2011). Although PTOX1 shows much lower
turnover rates than PTOX2, these observations imply that the oxidase could be
necessary for carotenoid synthesis in the alga, at least under specific conditions like
dark heterotrophy.
5.3 Oxygen Reduction at the Stromal Face of PSI
The capacity for the photosynthetic consumption of O2 resulting in the formation of

H2O2, and, most important at the time, the fact that this reaction is not immediately
linked to H2O splitting, was first described by Mehler in 1951 (Mehler 1951). In
principle, the reduction of O2 resulting in the formation of ROS can occur at any
place of the electron transport chain where highly reducing intermediates are
formed and have access to O2 (Rutherford et al. 2012). In the case of the reaction
observed by Mehler, this interface would likely be the terminal electron accepting
iron-sulphur cluster FB at the stromal side of PSI.
From there, O2 reduction results in the formation of O2• , which is subsequently
converted to H2O2 and O2 by a chloroplast superoxide dismutase (SOD). Alterna-
tively, a reduction of O2 at the stromal face of PSI can be facilitated by flavodiiron
proteins (FDPs) which avoid ROS formation. In any way, utilizing the full linear
electron transport chain from H2O splitting at PSII through the Cyt b6f complex to
O2 reduction to H2O at PSI, these water-to-water cycles contribute to the buildup of
the trans-thylakoid proton gradient and therefore support all mechanisms requiring
this gradient like ATP synthesis or photoprotection but do not result in NAD(P)H
formation.
5.3.1 Superoxide Dismutase
Various isoforms of the metal-bearing SODs exist throughout all kingdoms of life,
the most common containing iron (FeSOD), manganese (MnSOD), combined
copper and zinc (Cu/ZnSOD) or nickel (NiSOD) as cofactors. FeSODs and
MnSODs are evolutionary closely related, whereas neither Cu/ZnSODs nor
NiSODs have a close relationship to the other SODs (Fink and Scandalios 2002;
Priya et al. 2007). Most photosynthetic organisms contain combinations of
Cu/ZnSODs with FeSODs and MnSODs, a notable exception being the chlorophyte
green algae, including C. reinhardtii, which lack Cu/ZnSODs (Asada et al. 1977).
So far, the consequence of this difference in the composition of primary antioxidant
enzymes is unclear: For Cu/ZnSODs, very high enzymatic activities have been
reported, and the enzymes are estimated to be present in stoichiometric amounts
when compared to PSI. Furthermore, immune-labelling experiments in spinach
chloroplasts illustrate a thylakoid membrane association leading to the formation
of ROS-scavenging microdomains at the stromal face of PSI, leading to immediate
O2• disproportionation when generated at the photosystem (Ogawa et al. 1995).
On the other hand, FeSODs have also been found associated with the thylakoid
membrane (Friso et al. 2010), and overexpression of FeSODs but not Cu/ZnSODs
in tobacco facilitates higher tolerance to methyl viologen-stimulated, light-depen-
dent oxidative stress (Van Camp et al. 1996). C. reinhardtii retains FeSOD levels
even under iron limitation, while PSI and other iron-containing chloroplast proteins
are degraded. Moreover, an additional chloroplast-localized MnSOD is induced
under these conditions, stretching the importance of the antioxidant defence system
in general and specifically under conditions in which the electron transport chain is
restructured (Page et al. 2012).
The H2O2 arising from the activity of SODs is less reactive than other ROS and,
potentially for this matter, is also an important signalling molecule. However, there
is a need for further processing of the compound, as it is still a strong oxidant and
has been shown to inhibit key biochemical pathways, most importantly CO2
fixation by the CBB cycle (Kaiser 1976). A variety of chloroplast-localized
enzymes function in H2O2 detoxification, namely, ascorbate peroxidase (APX),
glutathione peroxidase (GPX) and peroxiredoxins (PRXs). It should be kept in mind
that H2O2 is membrane permeable to a small extent, can be transported across
membranes (Bienert et al. 2006) and is indicated to diffuse out of the chloroplast
(Takeda et al. 1997). Therefore, the scavenging of ROS produced at the photosyn-
thetic electron transport chain might not be confined to the compartment of its
generation.
5.3.2 Ascorbate Peroxidase
In plants, the H2O2-scavenging enzyme catalase is present in peroxisomes but not in

the chloroplast. A major step towards solving the puzzle of ROS detoxification in
the photosynthetic compartment was the discovery of thylakoid-bound APX
(Groden and Beck 1979) and soluble APX in the stroma (Kelly and Latzko 1979)
in the late 1970s. Together with findings of enzymes involved in glutathione and
ascorbate metabolism in the chloroplast (Foyer and Halliwell 1976, 1977), the
glutathione-ascorbate or Foyer-Halliwell-Asada cycle was established. The first
step in this cycle is the reduction of H2O2 with electrons derived from ascorbate,
leading to the formation of H2O and monodehydroascorbate (MDA). MDA is then
re-reduced to ascorbate, either with electrons derived from FDX or from NAD(P)H,
or a spontaneous disproportionation leads to the formation of dehydroascorbate
(DHA). In this case, DHA can be re-reduced to ascorbate via a glutathione (GSH)-
dependent system which ultimately derives its electrons from NAD(P)H as well.
APX belongs to the family of class I heme-bearing peroxidases (Raven et al.
2004). In C. reinhardtii, it is localized in the chloroplast stroma, but in contrast to
vascular plants, no thylakoid membrane-associated isoform seems to be present
(Takeda et al. 1997). This difference is especially noteworthy, as the membrane-
bound APX of vascular plants is expected to be co-located with SOD in
ROS-scavenging microdomains around PSI (Asada 2000), which would therefore
not be present in the alga. Further comparison based on in vitro analysis of the
C. reinhardtii enzyme showed an elevated affinity for ascorbate but lower catalytic
turnover (Takeda et al. 1997). Regarding the affinity, these results could point
towards an adaptation of the enzyme to lower substrate levels [intracellular ascor-
bate levels up to 1 mM have been reported in C. reinhardtii (Urzica et al. 2012), in
contrast to levels between 20 mM and 300 mM in vascular plant chloroplasts
(Smirnoff 2000)]. In line with this hypothesis are reports describing an inactivation
of plant APX at low ascorbate availability (Chen and Asada 1989), whereas the
isolated algal APX was much more stable under these conditions.
5.3.3 Peroxiredoxins and Glutathione Peroxidases
As an alternative to H2O2 detoxification by APX, photosynthetic organisms contain

a set of thiol peroxidases. These include the enzyme families of GPXs and PRXs,
which are evolutionary distinct (Dietz 2016), but function according to a similar
reaction mechanism. H2O2 can be targeted by these enzymes; however, they have a
broader range of potential targets, including alkyl hydroperoxides and
peroxynitrite. The general mechanism consists of a reduction of the targeted
peroxide by an active cysteine, leading to the formation of sulfenic acid. The
sulfenic acid is then converted to a disulphide by intra- or intermolecular reaction
with another catalytic cysteine residue. Subsequently, the active (reduced) form of
the enzyme is restored through reduction by GSH, a TRX or a glutaredoxin, with
the electrons ultimately being derived from NAD(P)H or reduced FDX generated
by photosynthetic electron transfer. Deviating from this mechanism are
selenocysteine-containing GPX (selenoGPX) and monomeric, single cysteine-
containing PRX (1-cysPRX) (Dayer et al. 2008; Dietz 2011).
Two recent studies based on genome analyses revealed the presence of seven
PRX and five GPX sequences (Dayer et al. 2008) or seven PRX and nine GPX
sequences (Pitsch et al. 2010) in the C. reinhardtii genome. Based on EST screen-
ing, at least six of these PRXs and five of the GPXs are expressed. Of those
expressed, three PRXs and three GPXs are potentially targeted to the chloroplast.
The PRX family is further divided into the subgroups of 2-cys PRXs, type
II-PRXs and PRXQs, of which one of each is expressed and likely targeted to the
chloroplast, as well as 1-cys PRXs, which seems to be absent in C. reinhardtii. Out
of these, the 2-cys PRX Ch-PRX1 is the first and so far only PRX from the alga
which has been isolated and characterized in vitro (Goyer et al. 2002). As described
for other members of this group, Ch-PRX1 is present as a functional dimer with
each monomer bearing one of the cysteine residues necessary for the reaction
mechanism. Strengthening the notion of an involvement in detoxification of
photo-generated ROS, Ch-PRX1 gene expression was found to depend on light
and/or oxidative stress. The implemented isolation procedure took advantage of the
affinity of TRX for Ch-PRX1, implicating that its active form is restored by the
TRX system once oxidized. In a recent publication, efficient electron transfer
between Ch-PRX1 and calredoxin (CRX), a calcium-dependent TRX has been
demonstrated (Hochmal et al. 2016). All the peroxide-scavenging reaction cascades
are inherently implicated to influence cellular ROS signalling. Consequently, the
novel CRX is at the crossroad between ROS and Ca2+ signalling (Hochmal et al.
2015). In line, downregulation of CRX expression by an amiRNA strategy or
insertional mutagenesis leads to increased lipid peroxidation in C. reinhardtii
(Hochmal et al. 2015). Regarding the function in ROS signalling, an interesting
feature of 2-cys PRXs is their reversible inactivation by hyperoxidation. This
transient inactivation is thought to support ROS signalling and allow cellular
acclimation in situations of excessive peroxide formation (Dietz 2011). In addition,
2-cys PRXs from multiple organisms from yeast to vascular plants have been
shown to form multimeres which have been described to adopt chaperone functions
and protect other proteins from degradation under stress conditions (Jang et al.
2004; Aran et al. 2008; Kim et al. 2009).
Out of the PRX variants, 2-cys PRX was shown to be by far most abundant
within the chloroplast stroma in A. thaliana (Peltier 2005). Given the fact that
Ch-PRX1 is so far the only PRX which could be isolated from C. reinhardtii, this is
likely to hold true for the alga as well. Evidence of physiological relevance of the
two other PRX types found in the chloroplast, the type II-PRX Ch-PRX5 and the
PRXQ Ch-PRX6 (in the nomenclature of Dayer et al.) is scarce (Dayer et al. 2008).
Studies from vascular plants indicate that PRXQ is associated with the thylakoid
membrane in the vicinity of PSII (Lamkemeyer et al. 2006) and/or could even be
targeted to the lumen (Petersson et al. 2006). Judging from the phenotype of
A. thaliana plants with altered PRXQ content, the function of the enzyme may be
related to photosynthesis. In contrast to 2-cys PRX and PRXQ, chloroplast type
II-PRX of A. thaliana was characterized as a soluble protein in the stroma (Dietz
et al. 2006). In the cyanobacterium Synechocystis sp. strain PCC6803, this type of
PRX was shown to be crucial for the growth of cultures when photosynthesizing in
the presence of O2 even at comparably low light intensities (Kobayashi et al. 2004).
Based on the data available so far, a contribution of each type of PRX present in the
chloroplast to a light-driven water-to-water cycle seems possible.
The same holds true for the potentially chloroplast-localized GPXs described so
far. Two out of these three enzymes, Ch-GPX1 and Ch-GPX2, are selenocysteine-
containing GPXs (selenoGPXs). Selenocysteine-containing proteins are wide-
spread amongst organisms but absent from yeast, some animals and embryophytes.
Hypothetically, the low redox potential of selenocysteine led to selection pressure
against its utilization once the O2 concentration in the atmosphere was increasing,
whereas an O2-buffering aquatic environment led to organisms retaining these
enzymes (Lobanov et al. 2007). Non-selenocysteine-containing GPXs (NS-GPXs)
and selenoGPXs show high sequence similarity, but the selenocysteine in their
active site is replaced by a cysteine. Regarding the reaction sequence, selenoGPXs
are reduced by GSH in a two-step mechanism not involving disulphide formation
within the enzyme or with another subunit (Johansson et al. 2005). In contrast,
NS-GPXs act via the standard PRX/GPX reaction mechanism described above, and
like PRX their reduction is rather dependent on TRX than on GSH. Based on their
redox properties, their peroxidase activities should be lower than those of
selenoGPXs. One NS-GPX, Ch-GPX5, might be present in two isoforms, one of
which is potentially located in the chloroplast and one in the cytosol. Based on EST
analysis, this is also the most highly expressed GPX isoform in C. reinhardtii
(Dayer et al. 2008).
Transcription studies firmly established an involvement of Ch-GPX5 in ROS
response. Expression of the corresponding gene is increased in response to singlet
oxygen- and organic peroxide-induced oxidative stress (Leisinger et al. 2001),
amongst other stresses likely leading to intracellular formation of these compounds
(Ledford et al. 2004; Fischer et al. 2006). Conversely, mutants screened for high
Ch-GPX5 expression show coinciding elevated singlet oxygen production (Fischer
et al. 2010). The notion that the enzyme is involved in ROS protection is further
underpinned when looking at the protein level, where Ch-GPX5 overexpression
lines show enhanced tolerance to oxidative stress (Ledford et al. 2007; Fischer et al.
2012). For the selenoGPX isoforms, the situation is less clear: So far, CrGPX1 has
been reported to be upregulated on transcript level in sulphur-starved cells (Zhang
et al. 2004). Earlier reports show strong dependency of scavenging of externally
added H2O2 on a selenite-containing GPX in cultures supplemented with sodium
selenite (Takeda et al. 1997). However, the identity of the GPX causing this effect
was not revealed.
5.3.4 Flavodiiron Proteins
The presence of an additional pathway for PSI-driven O2 photoreduction is impli-

cated by the presence of flavodiiron proteins (FDPs) in the chloroplast of
C. reinhardtii. Evidence for an involvement of this type of enzyme in photosyn-
thesis was first found in the cyanobacterium Synechocystis, where electron trans-
port upon a dark to light transition is strongly dependent on O2 as electron acceptor.
Knockout mutants of the encoding genes FLV1 and/or FLV3 show multiple related
phenotypes like inhibition of light-driven O2 uptake, acceptor side limitation of PSI
and increased reduction of the electron transport chain upon a transition to light in
dark-adapted cells (Helman et al. 2003). In the same line, the mutants also exhibit a
decrease of PSI levels, likely due to ROS-induced photodamage, accompanied by a
severe growth phenotype, when grown under fluctuating light (Allahverdiyeva et al.
2013). FDPs are capable of direct O2 reduction without intermediate ROS forma-
tion, a mechanism which is consequently termed Mehler-like reaction. Evolution-
ary, FDPs share homologies with a-type flavoproteins charged with the
detoxification of O2 or NO in anaerobic archaea and bacteria. They are present in
a multitude of eukaryotic organisms but notably absent from diatoms, haptophytes
and vascular plants (Peltier et al. 2010). Despite the absence from vascular plants, a
recent study, in which FDPs originating from the moss P. patens were heterolo-
gously expressed in A. thaliana, illustrated that these enzymes can still functionally
interact with the electron transfer chain in the chloroplasts of angiosperms and even
show potential to increase plant fitness under certain conditions as fluctuating light
or in the pgr5 background (Yamamoto et al. 2016). In photosynthetic organisms, a
NAD(P)H:flavin oxidoreductase is fused C-terminally to the FDP, placing NAD(P)
H at the intersection between thylakoid membrane-embedded electron transport
and this mechanism of O2 reduction (Vicente et al. 2002).
In the genome of C. reinhardtii, two genes encoding FLVA and FLVB are
present (Peltier et al. 2010). Protein abundance was found to be elevated in pgrl1
strains (Dang et al. 2014), where they potentially function as additional electron
sink, thereby decreasing the elevated redox pressure on PSI caused by the mutation
(see Sect. 3.2). In wildtype C. reinhardtii cells, transcript and protein levels were
shown to change depending on growth light and/or CO2 availability and also
transiently increase upon a shift to sulphur-limited medium (Jokel et al. 2015).
Changes in light or CO2 availability are expected to modulate the redox pressure
exerted on the photosynthetic electron transport chain. FDPs would play a role as a
safety valve downstream of PSI, similar as is discussed for PTOX downstream of
PSII. A similar role can be inferred during the initial phase of sulphur starvation, but
additionally, the transient induction seems to advance the acclimation process by
driving light-dependent O2 uptake before the O2-sensitive hydrogenase and fer-
mentation take over.
6 Concluding Remarks
The primary function of photosynthesis is the conversion of light energy into

chemical energy. At the first glance, this task seems readily achieved by performing
photosynthetic linear electron transfer (LEF, Fig. 1a), providing reducing equiva-
lents in the form of NADPH and an electrochemical proton gradient across the
thylakoid membrane which is utilized to build up high-energy compounds in
the form of ATP. NADPH and ATP are then consumed by carbon fixation via the
Calvin-Benson-Bassham (CBB) cycle, using these primary products to build up
organic compounds necessary for cell growth and long-term energy storage. The
CBB cycle demands ATP and NADPH in a fixed ratio of 1.5, while LEF itself can
only provide these compounds at a ratio of 1.38, so that “simply” running LEF is
not sufficient for organisms to thrive based on light energy alone (Allen 2002).
Generally, the ATP demand can be satisfied by utilizing some of the captured light
energy to run cyclic electron flow around photosystem I (CEF, Fig. 1b), which is
considered to be the major auxiliary pathway allowing balanced photosynthetic
energy conversion. But photosynthesis is inextricably linked with the widely
branched network of cellular metabolism, and in their natural habitats, organisms
experience a large variety of different stresses, coping with each of which requires
the consumption of some form of energy. Diverting electrons towards various
metabolic pathways at the level of ferredoxin (FDX) represents one mechanism
to address this issue. Furthermore, the light-capturing machinery itself is able to
react in a highly flexible manner depending on external stimuli. Even in the absence
of light, chlororespiration provides a way to integrate cellular metabolism to the
status of the photosynthetic electron transport chain through the consumption of
reducing equivalents (Fig. 1c). During illumination, a challenge is posed by the
fluctuating availability and quality of the primary energy source itself, especially in
combination with the task of carrying out redox reactions in an O2-rich atmosphere.
Photosystems have evolved to minimize the occurrence of hazardous direct O2
reduction; state transitions and non-photochemical quenching (NPQ) allow the
regulation of energy influx in response to different light availabilities. Further
down the line, the electrochemical proton gradient resulting from light-driven
electron transfer itself functions as a feedback system implemented through the
mechanisms of photosynthetic control and pmf partitioning. In the case of limited
availability of the oxidized primary electron acceptor NADP+, the presence of
Fig. 1 Overview of the various electron transfer/metabolic pathways described in this chapter.
Reaction steps contributing to the buildup of reducing power are depicted in a colour gradient
towards dark green. Reaction steps leading to consumption of reducing power are depicted in
colour gradients towards yellow. Protons translocated from the stroma to the thylakoid lumen and
enzyme complexes contributing to the buildup of the proton motive force (ΔμH+ or pmf) are shown
in wine red. In a, ATP consumption in the Calvin-Benson-Bassham (CBB) cycle is highlighted by
a colour gradient from red to blue. For detailed description, refer to text. a, b, c, d and e, depiction
of LEF, CEF, chlororespiration, Mehler reaction/ROS detoxification and Mehler-like reactions
flavodiiron proteins (FDPs) in C. reinhardtii allows for safe utilization of O2 as an

alternative electron acceptor (Fig. 1e) while still allowing buildup of the trans-
thylakoid proton gradient for ATP synthesis. Despite all these security measures,
generation of ROS still occurs, amongst others, through the Mehler reaction at the
stromal face of PSI. In this case, reducing power is diverted towards detoxification
mechanisms to prevent excessive damage within the chloroplast and the whole cell
(Fig. 1d; Table 1).
The mechanisms described in this chapter only represent a fraction of all the
mechanisms necessary to allow a safe utilization of light energy, and to this day, the
Table 1 Summary of the discussed electron transfer pathways with their respective electron
donors, electron carriers, electron acceptors and products
Electron Electron
Electron transfer pathway donor Electron carriers acceptor Product
Linear electron flow H2O PSII, PQ, Cyt b6f, PC, NADP+ O2,
(LEF) (A) PSI, FDX, FNR NADPH,
ATP
FQR-dependent CEF (B) FDX(?) FNR? PQ ATP
NDH-dependent CEF (B) NAD(P) NDA2 PQ ATP
H
Chlororespiration (C) NAD(P) NDA2, PTOX O2 H2O
H
Mehler (D)-, Mehler (E)- PSI: FB – O2 O2• ,
like reactions NADPH FLV O2 H2O,
ATP
O2• detoxification (D) O2• (a) SOD O2• (b) O2 (a)
H2O2 (b)
H2O2 detoxification (D) Ascorbate APX H2O2 H2O,
FDX/ GPX/PRX MDA/
NADPH DHA
H2 production FDX Hydrogenase H+ H2,
ATP
interconnections between the resulting metabolic networks and the exact molecular
mechanisms behind them are not fully understood. However, our current knowl-
edge implies that in photosynthesis, a substantial amount of the captured energy is
utilized to ensure a safe functioning of the process itself, and, as a direct result of
this conclusion, a deepened knowledge of the underlying mechanisms will open a
wide variety of possibilities to ultimately improve the utilization of the sun as an
energy source.
Acknowledgments The research of MH is funded by the Deutsche Forschungsgemeinschaft

(Grant no. HI 739/13-1).
References
Ahmad N, Michoux F, Nixon PJ (2012) Investigating the production of foreign membrane proteins
in tobacco chloroplasts: expression of an algal plastid terminal oxidase. PLoS One. doi:10.1371/
journal.pone.0041722
Allahverdiyeva Y, Mustila H, Ermakova M, Bersanini L, Richaud P, Ajlani G, Battchikova N,
Cournac L, Aro E-M (2013) Flavodiiron proteins Flv1 and Flv3 enable cyanobacterial growth
and photosynthesis under fluctuating light. Proc Natl Acad Sci U S A 110:4111–4116
Allen JF (2002) Photosynthesis of ATP – electrons, proton pumps, rotors, and poise. Cell
110:273–276
Allorent G, Tokutsu R, Roach T, Peers G, Cardol P, Girard-Bascou J, Seigneurin-Berny D,
Petroutsos D, Kuntz M, Breyton C et al (2013) A dual strategy to cope with high light in
Chlamydomonas reinhardtii. Plant Cell 25:545–557
Allorent G, Lefebvre-legendre L, Chappuis R, Kuntz M, Truong TB (2016) UV-B photoreceptor-

mediated protection of the photosynthetic machinery in Chlamydomonas reinhardtii. 1–6
Alric J (2010) Cyclic electron flow around photosystem I in unicellular green algae. Photosynth
Res 106:47–56
Alric J (2014) Redox and ATP control of photosynthetic cyclic electron flow in Chlamydomonas
reinhardtii: (II) involvement of the PGR5-PGRL1 pathway under anaerobic conditions.
Biochim Biophys Acta 1837:825–834
Alric J, Lavergne J, Rappaport F (2010) Redox and ATP control of photosynthetic cyclic electron
flow in Chlamydomonas reinhardtii (I) aerobic conditions. Biochim Biophys Acta 1797:44–51
Aran M, Caporaletti D, Senn AM, Tellez De I~ non MT, Girotti MR, Llera AS, Wolosiuk RA (2008)
ATP-dependent modulation and autophosphorylation of rapeseed 2-Cys peroxiredoxin. FEBS
J 275:1450–1463
Armbruster U, Carrillo RL, Venema K, Pavlovic L, Schmidtmann E, Kornfeld A, Jahns P, Berry
JA, Kramer DM, Jonikas MC (2014) Ion antiport accelerates photosynthetic acclimation in
fluctuating light environments. Nat Commun 5:5439
Armbruster U, Leonelli L, Galvis VC, Strand D, Quinn EH, Jonikas MC, Niyogi KK (2016)
Regulation and levels of the thylakoid K+/H+ antiporter KEA3 shape the dynamic response of
photosynthesis in fluctuating light. Plant Cell Physiol 57:1557–1567
Asada K (2000) The water-water cycle as alternative photon and electron sinks. Philos Trans R
Soc Lond Ser B Biol Sci 355:1419–1431
Asada K, Kanematsu S, Uchida K (1977) Superoxide dismutases in photosynthetic organisms:
absence of the cuprozinc enzyme in eukaryotic algae. Arch Biochem Biophys 179:243–256
Avenson TJ, Cruz JA, Kanazawa A, Kramer DM (2005) Regulating the proton budget of higher
plant photosynthesis. Proc Natl Acad Sci 102(27):9709–9713
Baker NR (2008) Chlorophyll fluorescence: a probe of photosynthesis in vivo. Annu Rev Plant
Biol 59:89–113
Ballottari M, Truong TB, De Re E, Erickson E, Stella GR, Fleming GR, Bassi R, Niyogi KK
(2016) Identification of pH-sensing sites in the light harvesting complex stress-related 3 protein
essential for triggering non-photochemical quenching in Chlamydomonas reinhardtii. J Biol
Chem 291(14):7334–7346. doi:10.1074/jbc.M115.704601
Baltz A, Dang K-V, Beyly A, Auroy P, Richaud P, Cournac L, Peltier G (2014) Plastidial
expression of type II NAD(P)H dehydrogenase increases the reducing state of plastoquinones
and hydrogen photoproduction rate by the indirect pathway in Chlamydomonas reinhardtii1.
Plant Physiol 165:1344–1352
Baniulis D, Yamashita E, Zhang H, Hasan SS, Cramer WA (2008) Review structure–function of
the cytochrome b 6 f complex. Photochem Photobiol 84:1349–1358
Baxter A, Mittler R, Suzuki N (2014) ROS as key players in plant stress signalling. J Exp Bot
65:1229–1240
Bennoun P (1982) Evidence for a respiratory chain in the chloroplast. Proc Natl Acad Sci U S A
79:4352–4356
Ben-Shem A, Frolow F, Nelson N (2003) Crystal structure of plant photosystem I. Nature
426:630–635
Bergner SV, Scholz M, Trompelt K, Barth J, Gäbelein P, Steinbeck J, Xue H, Clowez S,
Fucile G, Goldschmidt-Clermont M et al (2015) State transition7-dependent phosphorylation
is modulated by changing environmental conditions and its absence triggers remodeling of
photosynthetic protein complexes. Plant Physiol 168:615–634
Bienert GP, Schjoerring JK, Jahn TP (2006) Membrane transport of hydrogen peroxide. Biochim
Biophys Acta Biomembr 1758:994–1003
Boehm M, Alahuhta M, Mulder DW, Peden EA, Long H, Brunecky R, Lunin VV, King PW,
Ghirardi ML, Dubini A (2015) Crystal structure and biochemical characterization of
Chlamydomonas FDX2 reveal two residues that, when mutated, partially confer FDX2 the
redox potential and catalytic properties of FDX1. Photosynth Res 128:45–57
Bonente G, Passarini F, Cazzaniga S, Mancone C, Buia MC, Tripodi M, Bassi R, Caffarri S (2008)
The occurrence of the psbs gene product in Chlamydomonas reinhardtii and in other
photosynthetic organisms and its correlation with energy quenching. Photochem Photobiol
84:1359–1370
Breyton C, Nandha B, Johnson GN, Joliot P, Finazzi G (2006) Redox modulation of cyclic
electron flow around photosystem I in C3 plants. Biochemistry 45:13465–13475
Busch A, Hippler M (2011) The structure and function of eukaryotic photosystem I. Biochim
Biophys Acta 1807:864–877
Cardol P, Bailleul B, Rappaport F, Derelle E, Béal D, Breyton C, Bailey S, Wollman FA,
Grossman A, Moreau H et al (2008) An original adaptation of photosynthesis in the marine
green alga Ostreococcus. Proc Natl Acad Sci U S A 105:7881–7886
Cardol P, Alric J, Girard-Bascou J, Franck F, Wollman FA, Finazzi G (2009) Impaired respiration
discloses the physiological significance of state transitions in Chlamydomonas. Proc Natl Acad
Sci U S A 106:15979–15984
Cardol P, Forti G, Finazzi G (2011) Regulation of electron transport in microalgae. Regul Electron
Transp Chloroplasts 1807:912–918
Carol P, Stevenson D, Bisanz C, Breitenbach J, Sandmann G, Mache R, Coupland G, Kuntz M
(1999) Mutations in the Arabidopsis gene IMMUTANS cause a variegated phenotype by
inactivating a chloroplast terminal oxidase associated with phytoene desaturation. Plant Cell
11:57–68
Carraretto L, Formentin E, Teardo E, Checchetto V, Tomizioli M, Morosinotto T, Giacometti GM,
Finazzi G, Szabó I (2013) A thylakoid-located two-pore K+ channel controls photosynthetic
light utilization in plants. Science 342:114–118
Chaux F, Peltier G, Johnson X (2015) A security network in PSI photoprotection: regulation of
photosynthetic control, NPQ and O2 photoreduction by cyclic electron flow. Front Plant Sci
6:1–7
Chen G, Asada K (1989) Ascorbate peroxidase in tea leaves: occurrence of two isozymes and the
differences in their enzymatic and molecular properties. Plant Cell Physiol 30:987–998
Chen H, Hu J, Qiao Y, Chen W, Rong J, Zhang Y, He C, Wang Q (2015) Ca2+-regulated cyclic
electron flow supplies ATP for nitrogen starvation-induced lipid biosynthesis in green alga. Sci
Rep 5:15117
Chen M, Zhang J, Zhao L, Xing J, Peng L, Kuang T, Rochaix J-D, Huang F (2016) Loss of algal
proton gradient regulation 5 increases ROS scavenging an H2 evolution. J Integr Plant
Biol:6772–6772
Clark RD, Hawkesford MJ, Coughlan SJ, Bennett J, Hind G (1984) Association of ferredoxin-
NADP+ oxidoreductase with the chloroplast cytochrome b-f complex. FEBS Lett 174:137–142
Clowez S, Godaux D, Cardol P, Wollman F-A, Rappaport F (2015) The involvement of hydrogen-
producing and ATP-dependent NADPH consuming pathways in setting the redox poise in the
chloroplast of Chlamydomonas reinhardtii in anoxia. J Biol Chem 290:8666–8676
Correa-Galvis V, Redekop P, Guan K, Grieß A, Truong TB, Wakao S, Niyogi KK, Jahns P (2016)
Photosystem II subunit PsbS is involved in the induction of LHCSR-dependent energy
dissipation in Chlamydomonas reinhardtii. J Biol Chem jbc.M116.737312
DalCorso G, Pesaresi P, Masiero S, Aseeva E, Schünemann D, Finazzi G, Joliot P, Barbato R,
Leister D (2008) A complex containing PGRL1 and PGR5 is involved in the switch between
linear and cyclic electron flow in Arabidopsis. Cell 132:273–285
Dang K-V, Plet J, Tolleter D, Jokel M, Cuiné S, Carrier P, Auroy P, Richaud P, Johnson X, Alric J
et al (2014) Combined increases in mitochondrial cooperation and oxygen photoreduction
compensate for deficiency in cyclic electron flow in Chlamydomonas reinhardtii. Plant Cell
26:1–16
Davis GA, Kanazawa A, Sch€ ottler MA, Kohzuma K, Froehlich JE, Rutherford AW, Satoh-
Cruz M, Minhas D, Tietz S, Dhingra A et al (2016) Limitations to photosynthesis by proton
motive force-induced photosystem II photodamage. elife 5:1–27
Dayer R, Fischer BB, Eggen RIL, Lemaire SD (2008) The peroxiredoxin and glutathione perox-
idase families in Chlamydomonas reinhardtii. Genetics 179:41–57
Delosme R, Olive J, Wollman F-A (1996) Changes in light energy distribution upon state
transitions: an in vivo photoacoustic study of the wild type and photosynthesis mutants from
Chlamydomonas reinhardtii. Biochim Biophys Acta Bioenerg 1273:150–158
Depège N, Bellafiore S, Rochaix J-D (2003) Role of chloroplast protein kinase Stt7 in LHCII
phosphorylation and state transition in Chlamydomonas. Science 299:1572–1575
Desplats C, Mus F, Cuiné S, Billon E, Cournac L, Peltier G (2009) Characterization of Nda2, a
plastoquinone-reducing type II NAD(P)H dehydrogenase in chlamydomonas chloroplasts.
J Biol Chem 284:4148–4157
Dietz K-J (2011) Peroxiredoxins in plants and cyanobacteria. Antioxid Redox Signal
15:1129–1159
Dietz K-J (2016) Thiol-based peroxidases and ascorbate peroxidases: why plants rely on multiple
peroxidase systems in the photosynthesizing chloroplast? Mol Cells 39:20–25
Dietz K-J, Stork T, Finkemeier I, Lamkemeyer P, Li W-X, El-Tayeb MA, Michel K-P, Pistorius E,
Baier M (2006) Photoprotection, photoinhibition, gene regulation, and environment. In:
Demmig-Adams B, Adams WW, Mattoo AK (eds) Advances in photosynthesis and respira-
tion. Springer Netherlands, Dordrecht, pp 303–319
Drop B, Webber-Birungi M, Fusetti F, Kourı̌l R, Redding KE, Boekema EJ, Croce R (2011)
Photosystem I of Chlamydomonas reinhardtii contains nine light-harvesting complexes (Lhca)
located on one side of the core. J Biol Chem 286:44878–44887
Drop B, Webber-Birungi M, Yadav SKN, Filipowicz-Szymanska A, Fusetti F, Boekema EJ, Croce
R (2014a) Light-harvesting complex II (LHCII) and its supramolecular organization in
Chlamydomonas reinhardtii. Biochim Biophys Acta 1837:63–72
Drop B, Yadav SKN, Boekema EJ, Croce R (2014b) Consequences of state transitions on the
structural and functional organization of Photosystem I in the green alga Chlamydomonas
reinhardtii. Plant J:181–191
Duan Z, Kong F, Zhang L, Li W, Zhang J (2016) A bestrophin-like protein modulates the proton
motive force across the thylakoid membrane in Arabidopsis. J Integr Plant Biol:1–32
Eberhard S, Finazzi G, Wollman FA (2008) The dynamics of photosynthesis. Annu Rev Genet
42:463–515
Fan M, Li M, Liu Z, Cao P, Pan X, Zhang H, Zhao X, Zhang J, Chang W (2015) Crystal structures
of the PsbS protein essential for photoprotection in plants. Nat Struct Mol Biol 22:729–735
Feilke K, Streb P, Gabriel C, Perreau F, Kruk J, Krieger-Liszkay A (2015) Effect of
Chamydomonas plastid terminal oxidase 1 expressed in tobacco on photosynthetic electron
transfer. Plant J 85:219–228
Finazzi G, Rappaport F (1998) In vivo characterization of the electrochemical proton gradient
generated in darkness in green algae and its kinetic effects on cytochrome b6f turnover.
Biochemistry 37:9999–10005
Finazzi G, Sommer F, Hippler M (2005) Release of oxidized plastocyanin from photosystem I
limits electron transfer between photosystem I and cytochrome b6f complex in vivo. Proc Natl
Acad Sci 102(19):7031–7036
Fink RC, Scandalios JG (2002) Molecular evolution and structure–function relationships of the
superoxide dismutase gene families in angiosperms and their relationship to other eukaryotic
and prokaryotic superoxide dismutases. Arch Biochem Biophys 399:19–36
Fischer BB, Eggen RIL, Trebst A, Krieger-Liszkay A (2006) The glutathione peroxidase homol-
ogous gene Gpxh in Chlamydomonas reinhardtii is upregulated by singlet oxygen produced in
photosystem II. Planta 223:583–590
Fischer BB, Eggen RIL, Niyogi KK (2010) Characterization of singlet oxygen-accumulating
mutants isolated in a screen for altered oxidative stress response in Chlamydomonas
reinhardtii. BMC Plant Biol 10:279
Fischer BB, Ledford HK, Wakao S, Huang SG, Casero D, Pellegrini M, Merchant SS, Koller A,
Eggen RIL, Niyogi KK (2012) SINGLET OXYGEN RESISTANT 1 links reactive electrophile
signaling to singlet oxygen acclimation in Chlamydomonas reinhardtii. Proc Natl Acad Sci
USA 109:E1302–E1311
Foyer CH, Halliwell B (1976) The presence of glutathione and glutathione reductase in chloro-
plasts: a proposed role in ascorbic acid metabolism. Planta 133:21–25
Foyer CH, Halliwell B (1977) Purification and properties of dehydroascorbate reductase from
spinach leaves. Phytochemistry 16:1347–1350
Friso G, Majeran W, Huang M, Sun Q, van Wijk KJ (2010) Reconstruction of metabolic pathways,
protein expression, and homeostasis machineries across maize bundle sheath and mesophyll
chloroplasts: large-scale quantitative proteomics using the first maize genome assembly. Plant
Physiol 152:1219–1250
Ghysels B, Godaux D, Matagne RF, Cardol P, Franck F (2013) Function of the chloroplast
hydrogenase in the microalga Chlamydomonas: the role of hydrogenase and state transitions
during photosynthetic activation in anaerobiosis. PLoS One. doi:10.1371/journal.pone.
0064161
Godaux D, Bailleul B, Berne N, Cardol P (2015) Induction of photosynthetic carbon fixation in
anoxia relies on hydrogenase activity and PGRL1-mediated cyclic electron flow in
Chlamydomonas reinhardtii. Plant Physiol 168:00105.2015
Goldschmidt-Clermont M, Bassi R (2015) Sharing light between two photosystems: mechanism of
state transitions. Curr Opin Plant Biol 25:71–78
Goss T, Hanke GT (2014) The end of the line: can ferredoxin and ferredoxin NADP
(H) oxidoreductase determine the fate of photosynthetic electrons? Curr Protein Pept Sci
15:385–393
Goyer A, Haslekås C, Miginiac-Maslow M, Klein U, Le Marechal P, Jacquot JP, Decottignies P
(2002) Isolation and characterization of a thioredoxin-dependent peroxidase from
Chlamydomonas reinhardtii. Eur J Biochem 269:272–282
Groden D, Beck E (1979) H2O2 destruction by ascorbate-dependent systems from chloroplasts.
BBA-Bioenergetics 546:426–435
Grossman AR, Catalanotti C, Yang W, Dubini A, Magneschi L, Subramanian V, Posewitz MC,
Seibert M (2011) Multiple facets of anoxic metabolism and hydrogen production in the
unicellular green alga Chlamydomonas reinhardtii. New Phytol 190:279–288
Haehnel W, Jansen T, Gause K, Kl€ osgen RB, Stahl B, Michl D, Huvermann B, Karas M,
Herrmann RG (1994) Electron transfer from plastocyanin to photosystem I. EMBO J
13:1028–1038
Hald S, Nandha B, Gallois P, Johnson GN (2008) Feedback regulation of photosynthetic electron
transport by NADP(H) redox poise. Biochim Biophys Acta 1777:433–440
Helman Y, Tchernov D, Reinhold L, Shibata M, Ogawa T, Schwarz R, Ohad I, Kaplan A (2003)
Genes encoding A-type flavoproteins are essential for photoreduction of O2 in cyanobacteria.
Curr Biol 13:230–235
Hemschemeier A, Happe T (2011) Alternative photosynthetic electron transport pathways during
anaerobiosis in the green alga Chlamydomonas reinhardtii. Biochim Biophys Acta
1807:919–926
Herdean A, Nziengui H, Zsiros O, Solymosi K, Garab G, Lundin B, Spetea C (2016a) The
arabidopsis thylakoid chloride channel AtCLCe functions in chloride homeostasis and regula-
tion of photosynthetic electron transport. Front Plant Sci 7:1–15
Herdean A, Teardo E, Nilsson AK, Pfeil BE, Johansson ON, Ünnep R, Nagy G, Zsiros O, Dana S,
Solymosi K et al (2016b) A voltage-dependent chloride channel fine-tunes photosynthesis in
plants. Nat Commun 7:11654
Hertle AP, Blunder T, Wunder T, Pesaresi P, Pribil M, Armbruster U, Leister D (2013) PGRL1 is
the elusive ferredoxin-plastoquinone reductase in photosynthetic cyclic electron flow. Mol Cell
49:511–523
Heyno E, Gross CM, Laureau C, Culcasi M, Pietri S, Krieger-Liszky A (2009) Plastid alternative
oxidase (PTOX) promotes oxidative stress when overexpressed in tobacco. J Biol Chem
284:31174–31180
Hippler M, Reichert J, Sutter M, Zak E, Altschmied L, Schr€ oer U, Herrmann RG, Haehnel W
(1996) The plastocyanin binding domain of photosystem I. EMBO J 15:6374–6384
Hippler M, Drepper F, Farah J, Rochaix J (1997) Fast electron transfer from cytochrome c6 and
plastocyanin to photosystem I of Chlamydomonas reinhardtii requires PsaF. Biochemistry
36:6343–6349
Hippler M, Drepper F, Haehnel W, Rochaix J-D (1998) The N-terminal domain of PsaF: precise
recognition site for binding and fast electron transfer from cytochrome c6 and plastocyanin to
photosystem I of Chlamydomonas reinhardtii. Proc Natl Acad Sci U S A 95:7339–7344
Hochmal AK, Schulze S, Trompelt K, Hippler M (2015) Calcium-dependent regulation of
photosynthesis. Biochim Biophys Acta 1847:993–1003
Hochmal AK, Zinzius K, Charoenwattanasatien R, Gäbelein P, Mutoh R, Tanaka H, Schulze S,
Liu G, Scholz M, Nordhues A et al (2016) Calredoxin represents a novel type of calcium-
dependent sensor-responder connected to redox regulation in the chloroplast. Nat Commun.
doi:10.1038/ncomms11847
Houille-Vernes L, Rappaport F, Wollman F-A, Alric J, Johnson X (2011) Plastid terminal oxidase
2 (PTOX2) is the major oxidase involved in chlororespiration in Chlamydomonas. Proc Natl
Acad Sci 108:20820–20825
Iwai M, Takizawa K, Tokutsu R, Okamuro A, Takahashi Y, Minagawa J (2010a) Isolation of the
elusive supercomplex that drives cyclic electron flow in photosynthesis. Nature
464:1210–1213
Iwai M, Yokono M, Inada N, Minagawa J (2010b) Live-cell imaging of photosystem II antenna
dissociation during state transitions. Proc Natl Acad Sci U S A 107:2337–2342
Jacobs J, Pudollek S, Hemschemeier A, Happe T (2009) A novel, anaerobically induced ferredoxin
in Chlamydomonas reinhardtii. FEBS Lett 583:325–329
Janero DR, Barrnett R (1982) Thylakoid membrane biogenesis in Chlamydomonas reinhardtii
137+. II. Cell-cycle variations in the synthesis and assembly of pigment. J Cell Biol
93:411–416
Jang HH, Lee KO, Chi YH, Jung BG, Park SK, Park JH, Lee JR, Lee SS, Moon JC, Yun JW et al
(2004) Two enzymes in one: two yeast peroxiredoxins display oxidative stress-dependent
switching from a peroxidase to a molecular chaperone function. Cell 117:625–635
Jans F, Mignolet E, Houyoux P-A, Cardol P, Ghysels B, Cuiné S, Cournac L, Peltier G,
Remacle C, Franck F (2008) A type II NAD(P)H dehydrogenase mediates light-independent
plastoquinone reduction in the chloroplast of Chlamydomonas. Proc Natl Acad Sci U S A
105:20546–20551
Järvi S, Suorsa M, Aro EM (2015) Photosystem II repair in plant chloroplasts – regulation,
assisting proteins and shared components with photosystem II biogenesis. Biochim Biophys
Acta Bioenerg 1847:900–909
Johansson L, Gafvelin G, Arnér ESJ (2005) Selenocysteine in proteins – properties and biotech-
nological use. Biochim Biophys Acta - Gen Subj 1726:1–13
Johnson GN (2003) Thiol regulation of the thylakoid electron transport chain – a missing link in
the regulation of photosynthesis? Biochemistry 42:3040–3044
Johnson GN (2004) Controversy remains: regulation of pH gradient across the thylakoid mem-
brane. Trends Plant Sci 9:570–571
Johnson GN (2011) Reprint of: physiology of PSI cyclic electron transport in higher plants.
Johnson X, Alric J (2012) Interaction between starch breakdown, acetate assimilation, and
photosynthetic cyclic electron flow in Chlamydomonas reinhardtii. J Biol Chem
287:26445–26452
Johnson X, Steinbeck J, Dent RM, Takahashi H, Richaud P, Ozawa S-I, Houille-Vernes L,
Petroutsos D, Rappaport F, Grossman AR et al (2014) Proton gradient regulation 5-mediated
cyclic electron flow under ATP- or redox-limited conditions: a study of ΔATpase pgr5 and
ΔrbcL pgr5 mutants in the green alga Chlamydomonas reinhardtii. Plant Physiol 165:438–452
Jokel M, Kosourov S, Battchikova N, Tsygankov AA, Aro EM, Allahverdiyeva Y (2015)
Chlamydomonas flavodiiron proteins facilitate acclimation to anoxia during sulfur deprivation.
Plant Cell Physiol 56:1598–1607
Joliot P, Joliot A (2006) Cyclic electron flow in C3 plants. Biochim Biophys Acta 1757:362–368
Josse EM, Alcaraz JP, Labouré AM, Kuntz M (2003) In vitro characterization of a plastid terminal
oxidase (PTOX). Eur J Biochem 270:3787–3794
Kaiser W (1976) The effect of hydrogen peroxide on CO2 fixation of isolated intact chloroplasts.
BBA-Bioenergetics 440:476–482
Kelly GJ, Latzko E (1979) Soluble ascorbate peroxidase: detection in plants and use in vitamim C
estimation. Naturwissenschaften 66:617–619
Kim SY, Jang HH, Lee JR, Sung NR, Lee HB, Lee DH, Park DJ, Kang CH, Chung WS, Lim CO
et al (2009) Oligomerization and chaperone activity of a plant 2-Cys peroxiredoxin in response
to oxidative stress. Plant Sci 177:227–232
Kirchhoff H (2014) Diffusion of molecules and macromolecules in thylakoid membranes.
Biochim Biophys Acta Bioenerg 1837:495–502
Kobayashi M, Ishizuka T, Katayama M, Kanehisa M, Bhattacharyya-Pakrasi M, Pakrasi HB,
Ikeuchi M (2004) Response to oxidative stress involves a novel peroxiredoxin gene in the
unicellular cyanobacterium Synechocystis sp. PCC 6803. Plant Cell Physiol 45:290–299
Kramer DM, Avenson TJ, Edwards GE (2004a) Dynamic flexibility in the light reactions of
photosynthesis governed by both electron and proton transfer reactions. Trends Plant Sci
9:349–357
Kramer DM, Avenson TJ, Edwards GE (2004b) Response to Johnson: Controversy remains:
regulation of pH gradient across thylakoid membrane. Trends Plant Sci 9:571–572
Krieger A, Weis E (1993) The role of calcium in the pH-dependent control of Photosystem
II. Photosynth Res 37:117–130
Krieger-Liszkay A, Feilke K (2016) The dual role of the plastid terminal oxidase PTOX: between a
protective and a pro-oxidant function. Front Plant Sci 6:2015–2017
Kuhlgert S, Drepper F, Fufezan C, Sommer F, Hippler M (2012) Residues PsaB Asp612 and PsaB
Glu613 of photosystem I confer pH-dependent binding of plastocyanin and cytochrome c(6).
Kukuczka B, Magneschi L, Petroutsos D, Steinbeck J, Bald T, Powikrowska M, Fufezan C,
Finazzi G, Hippler M (2014) Proton gradient regulation5-like1-mediated cyclic electron flow
is crucial for acclimation to anoxia and complementary to nonphotochemical quenching in
stress adaptation. Plant Physiol 165:1604–1617
Kunz HH, Gierth M, Herdean A, Satoh-Cruz M, Kramer DM, Spetea C, Schroeder JI (2014)
Plastidial transporters KEA1, -2, and -3 are essential for chloroplast osmoregulation, integrity,
and pH regulation in Arabidopsis. Proc Natl Acad Sci USA 111:7480–7485
Kurisu G, Kusunoki M, Katoh E, Yamazaki T, Teshima K, Onda Y, Kimata-Ariga Y, Hase T
(2001) Structure of the electron transfer complex between ferredoxin and ferredoxin-NADP(+)
reductase. Nat Struct Biol 8:117–121
Kurisu G, Zhang H, Smith JL, Cramer WA (2003) Structure of the cytochrome b6f complex of
oxygenic photosynthesis: tuning the cavity. Science 302:1009–1014
Lamkemeyer P, Laxa M, Collin V, Li W, Finkemeier I, Sch€ ottler MA, Holtkamp V, Tognetti VB,
Issakidis-Bourguet E, Kandlbinder A et al (2006) Peroxiredoxin Q of Arabidopsis thaliana is
attached to the thylakoids and functions in context of photosynthesis. Plant J 45:968–981
Laureau C, De Paepe R, Latouche G, Moreno-Chacón M, Finazzi G, Kuntz M, Cornic G, Streb P
(2013) Plastid terminal oxidase (PTOX) has the potential to act as a safety valve for excess
excitation energy in the alpine plant species Ranunculus glacialis L. Plant Cell Environ
36:1296–1310
Ledford HK, Baroli I, Shin JW, Fischer BB, Eggen RIL, Niyogi KK (2004) Comparative profiling
of lipid-soluble antioxidants and transcripts reveals two phases of photo-oxidative stress in a
xanthophyll-deficient mutant of Chlamydomonas reinhardtii. Mol Gen Genomics 272:470–479
Ledford HK, Chin BL, Niyogi KK (2007) Acclimation to singlet oxygen stress in Chlamydomonas
reinhardtii. Eukaryot Cell 6:919–930
Leisinger U, Rüfenacht K, Fischer B, Pesaro M, Spengler A, Zehnder AJ, Eggen RI (2001) The
glutathione peroxidase homologous gene from Chlamydomonas reinhardtii is transcriptionally
up-regulated by singlet oxygen. Plant Mol Biol 46:395–408
Lemeille S, Willig A, Depège-Fargeix N, Delessert C, Bassi R, Rochaix J-D (2009) Analysis of the
chloroplast protein kinase Stt7 during state transitions. PLoS Biol 7:e45
Lennon AM, Prommeenate P, Nixon PJ (2003) Location, expression and orientation of the putative
chlororespiratory enzymes, Ndh and IMMUTANS, in higher-plant plastids. Planta
218:254–260
Li XP, Bj€orkman O, Shih C, Grossman AR, Rosenquist M, Jansson S, Niyogi KK (2000) A

pigment-binding protein essential for regulation of photosynthetic light harvesting. Nature
403:391–395
Li XP, Gilmore AM, Caffarri S, Bassi R, Golan T, Kramer D, Niyogi KK (2004) Regulation of
photosynthetic light harvesting involves intrathylakoid lumen pH sensing by the PsbS protein.
J Biol Chem 279:22866–22874
Liguori N, Roy LM, Opacic M, Durand G, Croce R, Roy LM (2013) Regulation of light harvesting
in the green alga Chlamydomonas reinhardtii: the C-terminus of LHCSR is the knob of a
dimmer switch. J Am Chem Soc 135:18339–18342
Lobanov AV, Fomenko DE, Zhang Y, Sengupta A, Hatfield DL, Gladyshev VN (2007) Evolu-
tionary dynamics of eukaryotic selenoproteomes: large selenoproteomes may associate with
aquatic life and small with terrestrial life. Genome Biol 8:R198
Lucker B, Kramer DM (2013) Regulation of cyclic electron flow in Chlamydomonas reinhardtii
under fluctuating carbon availability. Photosynth Res. doi:10.1007/s11120-013-9932-0
Malnoë A, Wang F, Girard-Bascou J, Wollman FA, de Vitry C (2014) Thylakoid FtsH protease
contributes to photosystem II and cytochrome b6f remodeling in Chlamydomonas reinhardtii
under stress conditions. Plant Cell 26:373–390
Maruyama S, Tokutsu R, Minagawa J (2014) Transcriptional regulation of the stress-responsive
light harvesting complex genes in Chlamydomonas reinhardtii. Plant Cell Physiol
55:1304–1310
Mehler AH (1951) Studies on reactions of illuminated chloroplasts. II. Stimulation and inhibition
of the reaction with molecular oxygen. Arch Biochem Biophys 34:339–351
Meyer Zu Tittingdorf JMW, Rexroth S, Schäfer E, Schlichting R, Giersch C, Dencher NA, Seelert
H (2004) The stoichiometry of the chloroplast ATP synthase oligomer III in Chlamydomonas
reinhardtii is not affected by the metabolic state. Biochim Biophys Acta Bioenerg 1659:92–99
Mitchell P (1961) Coupling of phosphorylation to electron and hydrogen transfer by a chemi-
osmotic type of mechanism. Nature 191(4784):144–148
Moore AL, Shiba T, Young L, Harada S, Kita K, Ito K (2013) Unraveling the heater: new insights
into the structure of the alternative oxidase. Annu Rev Plant Biol 64:637–663
Müller P, Li XP, Niyogi KK (2001) Non-photochemical quenching. A response to excess light
energy. Plant Physiol 125:1558–1566
Munekage Y, Hojo M, Meurer J, Endo T, Tasaka M, Shikanai T (2002) PGR5 is involved in cyclic
electron flow around photosystem I and is essential for photoprotection in Arabidopsis. Cell
110:361–371
Munekage YN, Genty B, Peltier G (2008) Effect of PGR5 impairment on photosynthesis and
growth in Arabidopsis thaliana. Plant Cell Physiol 49(11):1688–1698
Munekage Y, Hashimoto M, Miyake C, Tomizawa K, Endo T, Tasaka M, Shikanai T (2004)
Cyclic electron flow around photosystem I is essential for photosynthesis. Nature 429:579–582
Muranaka LS, Rütgers M, Bujaldon S, Heublein A, Geimer S, Wollman FA, Schroda M (2016)
TEF30 interacts with photosystem II monomers and is involved in the repair of photodamaged
photosystem II in Chlamydomonas reinhardtii. Plant Physiol 170:821–840
Murata N, Allakhverdiev SI, Nishiyama Y (2012) The mechanism of photoinhibition in vivo:
re-evaluation of the roles of catalase, α-tocopherol, non-photochemical quenching, and elec-
tron transport. Biochim Biophys Acta Bioenerg 1817:1127–1133
Mus F, Cournac L, Cardettini V, Caruana A, Peltier G (2005) Inhibitor studies on
non-photochemical plastoquinone reduction and H(2) photoproduction in Chlamydomonas
reinhardtii. Biochim Biophys Acta 1708:322–332
Nagy G, Unnep R, Zsiros O, Tokutsu R, Takizawa K, Porcar L, Moyet L, Petroutsos D, Garab G,
Finazzi G et al (2014) Chloroplast remodeling during state transitions in Chlamydomonas
reinhardtii as revealed by noninvasive techniques in vivo. Proc Natl Acad Sci U S A
111:5042–5047
Nandha B, Finazzi G, Joliot P, Hald S, Johnson GN (2007) The role of PGR5 in the redox poising
of photosynthetic electron transport. Biochim Biophys Acta Bioenerg 1767:1252–1259
Nawrocki WJ, Tourasse NJ, Taly A, Rappaport F, Wollman F-A (2014) The plastid terminal
oxidase: its elusive function points to multiple contributions to plastid physiology. Annu Rev
Plant Biol 66:150112150216002
Nawrocki WJ, Santabarbara S, Mosebach L, Wollman FA, Rappaport F (2016) State transitions
redistribute rather than dissipate energy between the two photosystems in Chlamydomonas.
Nat Plants 2:16031
Nelson N, Ben-Shem A (2004) The complex architecture of oxygenic photosynthesis. Nat Rev
Mol Cell Biol 5:971–982
Nelson N, Yocum CF (2006) Structure and function of photosystems I and II. Annu Rev Plant Biol
57:521–565
Nordling M, Sigfridsson K, Young S, Lundberg LG, Hansson Ö (1991) Flash-photolysis studies of
the electron transfer from genetically modified spinach plastocyanin to photosystem I. FEBS
Lett 291:327–330
Ogawa K, Kanematsu S, Takabe K, Asada K (1995) Attachment of CuZn-superoxide dismutase to
thylakoid membranes at the site of superoxide generation (PSI) in spinach chloroplasts:
detection by immuno-gold labeling after rapid freezing and substitution method. Plant Cell
Physiol 36:565–573
Page MD, Allen MD, Kropat J, Urzica EI, Karpowicz SJ, Hsieh SI, Loo JA, Merchant SS (2012)
Fe sparing and Fe recycling contribute to increased superoxide dismutase capacity in iron-
starved Chlamydomonas reinhardtii. Plant Cell 24:2649–2665
Peden EA, Boehm M, Mulder DW, Davis R, Old WM, King PW, Ghirardi ML, Dubini A (2013)
Identification of global ferredoxin interaction networks in chlamydomonas reinhardtii. J Biol
Chem 288:35192–35209
Peers G, Truong TB, Ostendorf E, Busch A, Elrad D, Grossman AR, Hippler M, Niyogi KK (2009)
An ancient light-harvesting protein is critical for the regulation of algal photosynthesis. Nature
462:518–521
Peltier J-B (2005) The oligomeric stromal proteome of Arabidopsis thaliana chloroplasts. Mol Cell
Peltier G, Ravenel J, Verméglio A (1987) Inhibition of a respiratory activity by short saturating
flashes in Chlamydomonas: evidence for a chlororespiration. BBA-Bioenergetics 893:83–90
Peltier G, Tolleter D, Billon E, Cournac L (2010) Auxiliary electron transport pathways in
chloroplasts of microalgae. Photosynth Res 106:19–31
Peltier G, Aro EM, Shikanai T (2016) NDH-1 and NDH-2 plastoquinone reductases in oxygenic
photosynthesis. Annu Rev Plant Biol 67:6.1–6.26
Peng L, Shimizu H, Shikanai T (2008) The chloroplast NAD(P)H dehydrogenase complex
interacts with photosystem I in Arabidopsis. J Biol Chem 283:34873–34879
Petersson UA, Kieselbach T, Garcı́a-Cerdán JG, Schr€ oder WP (2006) The Prx Q protein of
Arabidopsis thaliana is a member of the luminal chloroplast proteome. FEBS Lett
580:6055–6061
Petroutsos D, Terauchi AM, Busch A, Hirschmann I, Merchant SS, Finazzi G, Hippler M (2009)
PGRL1 participates in iron-induced remodeling of the photosynthetic apparatus and in energy
metabolism in Chlamydomonas reinhardtii. J Biol Chem 284:32770–32781
Petroutsos D, Busch A, Janssen I, Trompelt K, Bergner SV, Weinl S, Holtkamp M, Karst U,
Kudla J, Hippler M (2011) The chloroplast calcium sensor CAS is required for
photoacclimation in Chlamydomonas reinhardtii. Plant Cell 23:2950–2963
Petroutsos D, Tokutsu R, Maruyama S, Flori S, Greiner A, Magneschi L, Cusant L, Kottke T,
Mittag M, Hegemann P et al (2016) A blue-light photoreceptor mediates the feedback
regulation of photosynthesis. Nature 537:563–566
Pitsch NT, Witsch B, Baier M (2010) Comparison of the chloroplast peroxidase system in the
chlorophyte Chlamydomonas reinhardtii, the bryophyte Physcomitrella patens, the lycophyte
Selaginella moellendorffii and the seed plant Arabidopsis thaliana. BMC Plant Biol 10:133
Priya B, Premanandh J, Dhanalakshmi RT, Seethalakshmi T, Uma L, Prabaharan D, Subramanian
G (2007) Comparative analysis of cyanobacterial superoxide dismutases to discriminate
canonical forms. BMC Genomics 8:435
Raven EL, Lad L, Sharp KH, Mewies M, Moody PC (2004) Defining substrate specificity and
catalytic mechanism in ascorbate peroxidase. Biochem Soc Symp 38:27–38
Rochaix J-D (2014) Regulation and dynamics of the light-harvesting system. Annu Rev Plant Biol
65:287–309
Rosso D, Ivanov AG, Fu A, Geisler-Lee J, Hendrickson L, Geisler M, Stewart G, Krol M, Hurry V,
Rodermel SR et al (2006) IMMUTANS does not act as a stress-induced safety valve in the
protection of the photosynthetic apparatus of Arabidopsis during steady-state photosynthesis.
Rott M, Martins NF, Thiele W, Lein W, Bock R, Kramer DM, Sch€ ottler M a (2011) ATP synthase
repression in tobacco restricts photosynthetic electron transport, CO2 assimilation, and plant
growth by overacidification of the thylakoid lumen. Plant Cell 23:304–321
Rutherford AW, Osyczka A, Rappaport F (2012) Back-reactions, short-circuits, leaks and other
energy wasteful reactions in biological electron transfer: redox tuning to survive life in O2.
FEBS Lett 586:603–616
Sandmann G (2009) Evolution of carotene desaturation: the complication of a simple pathway.
Arch Biochem Biophys 483:169–174
Saroussi SI, Wittkopp TM, Grossman AR (2016) The type II NADPH dehydrogenase facilitates
cyclic electron flow, energy dependent quenching and chlororespiratory metabolism during
acclimation of Chlamydomonas reinhardtii to nitrogen deprivation. Plant Physiol pp 02014
(2015)
Shikanai T, Yamamoto H (2016) Contribution of cyclic and pseudo-cyclic electron transport to the
formation of proton motive force in chloroplasts. Mol Plant. doi:10.1016/j.molp.2016.08.004
Singh SK, Hasan SS, Zakharov SD, Naurin S, Whitelegge JP, Cramer WA, Lafayette W,
Pasarow T, Spectrometry M, Angeles L et al (2016) Trans-membrane signaling in photosyn-
thetic state transitions: redox- and structure-dependent interaction in vitro between Stt7 kinase
and cytochrome b6f complex. J Biol Chem. doi:10.1074/jbc.M116.732545
Smirnoff N (2000) Ascorbate biosynthesis and function in photoprotection. Philos Trans R Soc
Lond Ser B Biol Sci 355:1455–1464
Sommer F, Drepper F, Hippler M (2002) The luminal helix l of PsaB is essential for recognition of
plastocyanin or cytochrome c6 and fast electron transfer to photosystem I in Chlamydomonas
reinhardtii. J Biol Chem 277:6573–6581
Sommer F, Drepper F, Haehnel W, Hippler M (2004) The hydrophobic recognition site formed by
residues PsaA-Trp651 and PsaB-Trp627 of photosystem I in Chlamydomonas reinhardtii
confers distinct selectivity for binding of plastocyanin and cytochrome c 6. J Biol Chem
279:20009–20017
Sonoike K (2011) Photoinhibition of photosystem I. Physiol Plant 142:56–64
Steinbeck J, Nikolova D, Weingarten R, Johnson X, Richaud P, Peltier G, Hermann M,
Magneschi L, Hippler M (2015) Deletion of Proton Gradient Regulation 5 (PGR5) and
PGR5-Like 1 (PGRL1) proteins promote sustainable light-driven hydrogen production in
Chlamydomonas reinhardtii due to increased PSII activity under sulfur deprivation. Front
Plant Sci 6:1–11
Stepien P, Johnson GN (2009) Contrasting responses of photosynthesis to salt stress in the
glycophyte Arabidopsis and the halophyte thellungiella: role of the plastid terminal oxidase
as an alternative electron sink. Plant Physiol 149:1154–1165
Stiehl HH, Witt HT (1969) Quantitative treatment of the function of plastoquinone in photosyn-
thesis. Zeitschrift fur Naturforsch – Sect B J Chem Sci 24:1588–1598
Stroebel D, Choquet Y, Popot J-L, Picot D (2003) An atypical haem in the cytochrome b(6)f
complex. Nature 426:413–418
Suorsa M, Järvi S, Grieco M, Nurmi M, Pietrzykowska M, Rantala M, Kangasjärvi S,
Paakkarinen V, Tikkanen M, Jansson S et al (2012) PROTON GRADIENT REGULATION5
is essential for proper acclimation of Arabidopsis photosystem I to naturally and artificially
fluctuating light conditions. Plant Cell 24:2934–2948
Takahashi H, Clowez S, Wollman F-A, Vallon O, Rappaport F (2013) Cyclic electron flow is
redox-controlled but independent of state transition. Nat Commun 4:1954
Takahashi H, Okamuro A, Minagawa J, Takahashi Y (2014) Biochemical characterization of

photosystem I-associated light-harvesting complexes I and II isolated from state 2 cells of
chlamydomonas reinhardtii. Plant Cell Physiol 55:1437–1449
Takahashi H, Schmollinger S, Lee J-H, Schroda M, Rappaport F, Wollman F-A, Vallon O (2016)
The PETO protein interacts with other effectors of cyclic electron flow in Chlamydomonas.
Mol Plant. doi:10.1016/j.molp.2015.12.017
Takeda T, Ishikawa T, Shigeoka S (1997) Metabolism of hydrogen peroxide by the scavenging
system in Chlamydomonas reinhardtii. Physiol Plant 99:49–55
Terashima M, Specht M, Hippler M (2011) The chloroplast proteome: a survey from the
Chlamydomonas reinhardtii perspective with a focus on distinctive features. Curr Genet
57:151–168
Terashima M, Petroutsos D, Hüdig M, Tolstygina I, Trompelt K, Gäbelein P, Fufezan C, Kudla J,
Weinl S, Finazzi G et al (2012) Calcium-dependent regulation of cyclic photosynthetic
electron transfer by a CAS, ANR1, and PGRL1 complex. Proc Natl Acad Sci U S A
109:17717–17722
Terauchi AM, Lu S-F, Zaffagnini M, Tappa S, Hirasawa M, Tripathy JN, Knaff DB, Farmer PJ,
Lemaire SD, Hase T et al (2009) Pattern of expression and substrate specificity of chloroplast
ferredoxins from Chlamydomonas reinhardtii. J Biol Chem 284:25867–25878
Tibiletti T, Auroy P, Peltier G, Caffarri S (2016) Chlamydomonas reinhardtii PsbS protein is
functional and accumulates rapidly and transiently under high light. Plant Physiol pp. 00572
(2016)
Tikkanen M, Rantala S, Aro E-M (2015) Electron flow from PSII to PSI under high light is
controlled by PGR5 but not by PSBS. Front Plant Sci 6
Tokutsu R, Minagawa J (2013) Energy-dissipative supercomplex of photosystem II associated
with LHCSR3 in Chlamydomonas reinhardtii. Proc Natl Acad Sci U S A 110:10016–10021
Tokutsu R, Kato N, Bui KH, Ishikawa T, Minagawa J (2012) Revisiting the supramolecular
organization of photosystem II in Chlamydomonas reinhardtii. J Biol Chem 287:31574–31581
Tolleter D, Ghysels B, Alric J, Petroutsos D, Tolstygina I, Krawietz D, Happe T, Auroy P, Adriano
J-M, Beyly A et al (2011) Control of hydrogen photoproduction by the proton gradient
generated by cyclic electron flow in Chlamydomonas reinhardtii. Plant Cell 23:2619–2630
Trouillard M, Shahbazi M, Moyet L, Rappaport F, Joliot P, Kuntz M, Finazzi G (2012) Kinetic
properties and physiological role of the plastoquinone terminal oxidase (PTOX) in a vascular
plant. Biochim Biophys Acta Bioenerg 1817:2140–2148
Ünlü C, Drop B, Croce R, van Amerongen H (2014) State transitions in Chlamydomonas
reinhardtii strongly modulate the functional size of photosystem II but not of photosystem
I. Proc Natl Acad Sci U S A 111:3460–3465
Ünlü C, Polukhina I, Van Amerongen H (2015) Origin of pronounced differences in 77 K
fluorescence of the green alga Chlamydomonas reinhardtii in state 1 and 2. Eur Biophys
J. doi:10.1007/s00249-015-1087-9
Urzica EI, Adler LN, Page MD, Linster CL, Arbing MA, Casero D, Pellegrini M, Merchant SS,
Clarke SG (2012) Impact of oxidative stress on ascorbate biosynthesis in Chlamydomonas via
regulation of the VTC2 gene encoding a GDP-L-galactose phosphorylase. J Biol Chem
287:14234–14245
Van Camp W, Capiau K, Van Montagu M, Inzé D, Slooten L (1996) Enhancement of oxidative
stress tolerance in transgenic tobacco plants overproducing Fe-superoxide dismutase in chlo-
roplasts. Plant Physiol 112:1703–1714
Vicente JB, Gomes CM, Wasserfallen A, Teixeira M (2002) Module fusion in an A-type flavo-
protein from the cyanobacterium Synechocystis condenses a multiple-component pathway in a
single polypeptide chain. Biochem Biophys Res Commun 294:82–87
Vinyard DJ, Ananyev GM, Dismukes CG (2013) Photosystem II: the reaction center of oxygenic
photosynthesis. Annu Rev Biochem 82:577–606
Wagner V, Ullmann K, Mollwo A, Kaminski M, Mittag M, Kreimer G (2007) The

phosphoproteome of a Chlamydomonas reinhardtii eyespot fraction includes key proteins of
the light signaling pathway. Plant Physiol 146:772–788
Wang C, Yamamoto H, Shikanai T (2015) Role of cyclic electron transport around photosystem I
in regulating proton motive force. Biochim Biophys Acta Bioenerg 1847(9):931–938
Wang L, Yamano T, Takane S, Niikawa Y, Toyokawa C, Ozawa S, Tokutsu R, Takahashi Y,
Minagawa J, Kanesaki Y et al (2016) Chloroplast-mediated regulation of CO2-concentrating
mechanism by Ca2+-binding protein CAS in the green alga Chlamydomonas reinhardtii. Proc
Natl Acad Sci 113:201606519
Wei L, Derrien B, Gautier A, Houille-Vernes L, Boulouis A, Saint-Marcoux D, Malnoë A,
Rappaport F, de Vitry C, Vallon O et al (2014) Nitric oxide-triggered remodeling of chloroplast
bioenergetics and thylakoid proteins upon nitrogen starvation in Chlamydomonas reinhardtii.
Plant Cell 26:353–372
Whatley FR, Tagawa K, Arnon DI (1962) Separation of the light and dark reactions in electron
transfer during photosynthesis. Biochemistry 49:266–270
Wobbe L, Bassi R, Kruse O (2015) Multi-level light capture control in plants and green algae.
Trends Plant Sci xx:1–14
Wu D, Wright DA, Wetzel C, Voytas DF, Rodermel S (1999) The IMMUTANS variegation locus
of Arabidopsis defines a mitochondrial alternative oxidase homolog that functions during early
chloroplast biogenesis. Plant Cell 11:43–55
Xue H, Tokutsu R, Bergner SV, Scholz M, Minagawa J, Hippler M (2014) PSBR is required for
efficient binding of LHCSR3 to photosystem II – light-harvesting supercomplexes in
Chlamydomonas reinhardtii. Plant Physiol 167:1566–1578
Yadav KNS, Semchonok DA, Nosek L, Kouřil R, Fucile G, Boekema EJ, Eichacker LA (2017)
Supercomplexes of plant photosystem I with cytochrome b6f, light-harvesting complex II and
NDH. Biochim Biophys Acta Bioenerg 1858:12–20
Yamamoto H, Peng L, Fukao Y, Shikanai T (2011) An Src homology 3 domain-like fold protein
forms a ferredoxin binding site for the chloroplast NADH dehydrogenase-like complex in
Arabidopsis. Plant Cell 23:1480–1493
Yamamoto H, Takahashi S, Badger MR, Shikanai T (2016) Artificial remodelling of alternative
electron flow by flavodiiron proteins in Arabidopsis. Nat Plants 2:16012
Yang W, Catalanotti C, Wittkopp TM, Posewitz MC, Grossman AR (2015a) Algae after dark:
mechanisms to cope with anoxic/hypoxic conditions. Plant J 82:481–503
Yang W, Wittkopp TM, Li X, Warakanont J, Dubini A, Catalanotti C, Kim RG, Nowack ECM,
Mackinder LCM, Aksoy M et al (2015b) Critical role of Chlamydomonas reinhardtii
ferredoxin-5 in maintaining membrane structure and dark metabolism. Proc Natl Acad Sci U
S A 112:14978–14983
Yu Q, Feilke K, Krieger-Liszkay A, Beyer P (2014) Functional and molecular characterization of
plastid terminal oxidase from rice (Oryza sativa). Biochim Biophys Acta Bioenerg
1837:1284–1292
Zhang H, Whitelegge JP, Cramer WA (2001) Ferredoxin:NADP+ oxidoreductase is a subunit of
the chloroplast cytochrome b6f complex. J Biol Chem 276:38159–38165
Zhang Z, Shrager J, Jain M, Vallon O, Grossman AR, Chang C (2004) Insights into the survival of
Chlamydomonas reinhardtii during sulfur starvation based on microarray analysis of gene
expression insights into the survival of Chlamydomonas reinhardtii during sulfur starvation
based on microarray analysis of gene expression. Eukaryot Cell 3:1331–1348
Zito F, Finazzi G, Delosme R, Nitschke W, Picot D, Wollman F a (1999) The Qo site of
cytochrome b6f complexes controls the activation of the LHCII kinase. EMBO J
18:2961–2969
Chlamydomonas: Bioenergetic Pathways—
Regulation of Photosynthesis
State Transitions and qE Quenching
Jun Minagawa
Abstract Plants and algae have acquired the ability to acclimate to ever-changing
environments to survive. During photosynthesis, light energy is converted into
electrochemical energy by several membrane protein supercomplexes, which is
used to fix CO2. The efficiency of photosynthesis is modulated by many environ-
mental factors, including temperature, drought, CO2 concentration, and light.
Recently, our understanding of such regulations of photosynthesis and the under-
lying molecular mechanisms has increased considerably. The photosynthetic
supercomplexes undergo supramolecular reorganizations within a short time after
receiving environmental cues. Two such representative reorganization events
include state transitions that balance the excitation of the two photosystems and
qE quenching that thermally dissipates excess energy at the level of the light-
harvesting antenna. This chapter will focus on recent findings regarding the
environmental regulation of photosynthesis in model organisms, paying particular
attention to the unicellular green alga Chlamydomonas reinhardtii, illustrating the
dynamic behavior of the photosynthetic machineries in nature.
Abbreviation
Chl Chlorophyll
Cyt bf Cytochrome b6f complex
DCCD Dicyclohexylcarbodiimide
DCMU 3-(3,4-Dichlorophenyl)-1,1-dimethylurea
Fd Ferredoxin
HL High light
LHCI and LHCII Light-harvesting complex protein I and II
LL Low light
NPQ Non-photochemical quenching
J. Minagawa (*)
Division of Environmental Photobiology, National Institute for Basic Biology, 38
Nishigonaka, Okazaki 444-8585, Aichi, Japan

136 J. Minagawa
PQ Plastoquinone
PSI and PSII Photosystem I and II
RNAi RNA interference
Vx Violaxanthin
WT Wild type
Zx Zeaxanthin
α-DM n-Dodecyl-α-D-maltoside
β-DM n-Dodecyl-β-D-maltoside
1 Introduction
Photosynthesis is initiated by harvesting light, which leads to the electron transport

and the concomitant generation of proton motive force across the thylakoid
membranes. The NADPH generated with the electron flow and the ATP produced
with the proton motive force are required for assimilating carbon dioxide in the
Calvin-Benson cycle. Photosystem I (PSI) and photosystem II (PSII) represent
charge-separation devices on the thylakoid membranes that drive electron flow
using light energy. These two photosystems originated from a common prototype,
but today’s PSI and PSII complexes are specialized and have differences in the
organization of their light-harvesting systems, pigment compositions, electron
acceptors and donors, and several other features. This chapter begins with intro-
ducing the current knowledge of the components and the structures of the two
photosystems in Chlamydomonas reinhardtii under normal conditions and then
describes their regulation and how they are reorganized upon environmental cues.
PSII and its light-harvesting complex proteins (LHCIIs) constitute a large chlo-
rophyll (Chl)-protein supercomplex that is made up of more than 30 subunits. Light
energy captured by LHCIIs is transferred to the central dimeric core complex, where
it is trapped and used to drive electron flow from water to plastoquinone. In green
plants, LHCIIs are formed of two layers, the major trimeric and the minor mono-
meric LHCII proteins (Dekker and Boekema 2005). In the green alga C. reinhardtii,
there are four major LHCII proteins (types I–IV) with 5, 1, 2, and 1 isoforms
(LHCBM3, -4, -6, -8, and -9; LHCBM5; LHCBM2 and -7; LHCBM1), respectively
(Minagawa and Takahashi 2004), whereas in the vascular plant Arabidopsis
thaliana, there are three major trimeric LHCII proteins (types I–III) with 5, 4, and
1 isoforms (LHCB1.1–1.5, LHCB2.1–2.4, and LHCB3.1), respectively (Jansson
1999). The two minor LHCII proteins CP29 and CP26 are encoded by the LHCB4
and LHCB5, respectively, in C. reinhardtii (Teramoto et al. 2001; Minagawa 2009),
whereas A. thaliana contains another minor LHCII protein CP24 encoded by the
LHCB6.
Single-particle image analysis of electron micrographs revealed that these
LHCII proteins are bound to both sides of the central dimeric core complex, with
the core and the major LHCII trimers bordered by a few minor LHCII monomers
(Dekker and Boekema 2005) (Fig. 1). When spinach (Spinacia oleracea) thylakoid
Chlamydomonas: Bioenergetic Pathways—Regulation of Photosynthesis 137
Fig. 1 Supramolecular organization of PSII-LHCII and PSI-LHCI supercomplexes in green algae

and vascular plants. Top views of the PSII-LHCII supercomplex (a) and the PSI-LHCI
supercomplex (b) from C. reinhardtii based on single-particle image analysis by Tokutsu et al.
(2012) and Drop et al. (2011), respectively. Top views of the PSII-LHCII supercomplex from
spinach (c) and the PSI-LHCI supercomplex from pea (d) based on single-particle image analysis
by Dekker and Boekema (2005) and crystallography of the PSI-LHCI supercomplex (Amunts et al.
2010), respectively. All top-view images are from the lumenal side. The crystal coordinates were
obtained from the Protein Data Bank: PSII core, 3ARC; PSI-LHCI, 2WSC
membranes are solubilized with n-dodecyl-β-D-maltoside (β-DM) (Boekema et al.

1995, 1998; Hankamer et al. 1997; Nield et al. 2000b), one LHCII trimer is bound
strongly to each side of the core (C2S2 PSII-LHCII supercomplex). However, when
the membranes are solubilized with n-dodecyl-α-D-maltoside (α-DM), the PSII-
LHCII supercomplexes are organized as C2S2M1–2 L0–1 or C2S2M0L1–2, wherein
one to two moderately bound LHCII trimers and/or one loosely bound LHCII trimer
138 J. Minagawa
or one to two loosely bound LHCII trimers are associated with the C2S2-type
supercomplex (Boekema et al. 1999; Yakushevska et al. 2001). When A. thaliana
thylakoid membranes are solubilized with α-DM, the C2S2M2 organization is the
largest type observed (Ruban et al. 2003; Caffarri et al. 2009) (Fig. 1c). These
results from single-particle analysis were confirmed through the direct observation
of the thylakoid membranes by cryoelectron tomography (Daum et al. 2010; Kouřil
et al. 2011). When the PSII-LHCII supercomplex from the green alga C. reinhardtii
was prepared with high concentrations of β-DM (50 mM; 2.6%), the C2S2 organi-
zation appeared as in vascular plants (Nield et al. 2000a). The lack of M- and
L-trimers in C. reinhardtii in earlier reports was ascribed to the absence in this alga
of CP24 (Minagawa and Takahashi 2004), which was presumed to serve as a linker
between PSII core subunits and an M-trimer in A. thaliana (Kovács et al. 2006; de
Bianchi et al. 2008). However, both trimers were found in a more recent single-
particle analysis of the α-DM-solubilized PSII-LHCII supercomplex from
C. reinhardtii, in which three LHCII trimers were attached to each side of the
core (the C2S2M2L2 PSII-LHCII supercomplex) (Tokutsu et al. 2012) (Fig. 1a).
The supercomplex formed by PSI and its light-harvesting complex proteins
(LHCI) is also a large Chl-protein complex that is made up of nearly 20 subunits.
The PSI supercomplex collects light energy and drives electron flow from plasto-
cyanin to ferredoxin (Fd). The association of LHCIs with a monomeric PSI core
was determined by 2.8–3.3 Å crystal structures of the PSI-LHCI supercomplex
from pea (Pisum sativum), in which the side of the PsaF/J subunits was occupied by
the crescent-shaped LHCI belt (Amunts et al. 2010; Qin et al. 2015) (Fig. 1d). The
other side of the core is unoccupied under normal conditions, exposing the PsaH/I/L
subunits, but it can dock the mobile LHCII(s) under “State 2” conditions as
described below. In vascular plants, the LHCI belt is formed by the four LHCI
proteins in the order of Lhca1, -4, -2, and -3 (Fig. 1d). In C. reinhardtii, however,
9 LHCI proteins in total, encoded by the LHCA1–9 genes (Stauber et al. 2003;
Minagawa 2009), form a double-layered LHCI belt attached to the side of the PsaJ/
F/G subunits when grown under low light (LL) conditions (Drop et al. 2011)
(Fig. 1b). Proteomic studies demonstrated that the LHCI belt is in fact heteroge-
neously composed and several LHCI proteins are not present stoichiometrically
(Tokutsu et al. 2004; Stauber et al. 2009). The composition of LHCI proteins is
known to be variable in response to environmental changes, where downregulation,
degradation, or processing of LHCI polypeptides were reported, in particular iron
deficient conditions (Moseley et al. 2002; Nield et al. 2004; Tokutsu et al. 2004).
Because plants and algae typically do not have means to escape from adverse
environments such as high light (HL) or LL, cold or hot temperatures, drought, or
low CO2 concentration, their ability to acclimate to such conditions is crucial for
survival in their niches. The central unit of the photosystems, the core complex,
conducts charge separations. The components of these charge-separation devices
are almost completely conserved among cyanobacteria, eukaryotic algae, moss, and
vascular plants, likely because the process was sufficiently optimized when
cyanobacteria originally acquired the ability to oxidize water 2.7 billion years
ago by employing the system of a series of enzymes for oxygenic photosynthesis
that remains in use today (Brocks et al. 1999; Summons et al. 1999). Furthermore,
this core system is invariable in changing environments. The only exception is the
so-called photoinhibition, which is a multistep process of D1 protein degradation
upon HL illumination and the replacement of damaged D1 with a newly synthe-
sized D1 polypeptide (Nixon et al. 2010). Photoinhibition is, in one sense, a
deleterious event for PSII because it loses the activity, but, in another, it could
save all the downstream components from the events even more devastating,
namely, the production of more dangerous reactive oxygen species (Asada 1999).
Therefore, photoinhibition can be considered as a safety valve for the photosyn-
thetic electron transport.
In contrast to the core complex, the surrounding light-harvesting antenna is
diverse, flexible, and dynamic. Different photosynthetic organisms generally have
different antenna systems to take advantage of the light environment in their own
niches. Moreover, the light-harvesting performance of the antenna system in a
single species can be dynamically adjusted to different light regimes. The capabil-
ities of the light-harvesting antenna to acclimate are especially important for
photosynthetic organisms to optimize their photosynthetic performance and to
protect their photosynthetic machinery from the photooxidative damage in the
natural environment, where the quality and quantity of light fluctuates over time.
This chapter presents an overview of the two representative acclimation events
of photosystems in C. reinhardtii, state transitions, and qE quenching. These
acclimation events are accompanied by reorganization of photosystem
supercomplexes and super-supercomplexes.
2 State Transitions
2.1 Introduction
Each of the two charge-separation devices—PSI and PSII—in the thylakoid mem-
branes has a distinct pigment system with unique absorption characteristics. Thus,
an imbalance of energy distribution between the two photosystems tends to occur in
natural environments (Allen 1992; Bellafiore et al. 2005). Because the two photo-
systems are functionally connected in series under normal conditions, plants and
algae must constantly balance their excitation levels to ensure the optimal efficiency
of electron flow. State transitions are engaged in balancing the light-harvesting
capacities of the two photosystems. State 1 occurs when PSI is preferentially excited
and the light-harvesting capacities of PSII and PSI are increased and decreased,
respectively; this state is indicated by a higher Chl fluorescence yield at room
temperature. Conversely, State 2 occurs when PSII is preferentially excited and
the light-harvesting capacities of PSII and PSI are decreased and increased, respec-
tively, to readjust the excitation balance; this state can be monitored as a lower Chl
fluorescence yield at room temperature (Minagawa 2011) (Fig. 2).
140 J. Minagawa
Fig. 2 Schematic representation of state transitions; a transition from State 1 to State 2. Upper,
when PSI is preferentially excited, the stroma of chloroplast and the PQ pool are oxidized. Under
these conditions, LHCIIs are bound to PSII (State 1). Lower, when the PQ pool is reduced,
migration of the mobile LHCIIs from PSII to PSI occurs to establish State 2. bf, Cyt bf; Fd,
ferredoxin; Pc, plastocyanin
The core concept of state transitions has been documented, an instant redistri-
bution of the light-harvesting systems of the two photosystems (Bonaventura and
Myers 1969; Murata 1969) and of the molecular mechanisms that regulate the
redistribution, including the involvement of cytochrome b6 f (Cyt bf) (Wollman and
Lemaire 1988), the binding of PQH2 to the Qo-site of Cyt bf (Vener et al. 1997; Zito
et al. 1999), and the phosphorylation of LHCII by redox-dependent kinase
(s) (Depège et al. 2003). Moreover, evidence for the molecular events occurring
at PSII and PSI are rapidly accumulating owing to advances in genetic and
biochemical techniques using the green alga C. reinhardtii. This progress is due,
in part, to a unique ability of this alga, where much more LHCII (as much as 67%) is
involved in state transitions (Delosme et al. 1996) as compared with vascular plants
(only 20–25%) (Allen 1992).
2.2 Reorganization of the PSII Supercomplex During State

Transitions
The PSII supercomplex was hypothesized to be subjected to the large-scale

reorganization during a transition from State 1 to State 2, such that a large
number of LHCIIs forming the peripheral antenna for PSII are undocked upon
their phosphorylation (Haldrup et al. 2001; Iwai et al. 2008). However, recent
studies employing in vivo measurements and high-resolution biochemistry have
presented an alternative view of state transitions at the PSII side. By measuring
small-angle neutron scattering in living C. reinhardtii cells during state transi-
tions, Nagy and coworkers detected a strong periodicity of the thylakoids in State
1 with characteristic repeat distances of approximately 200 Å, which was almost
completely lost in State 2 (Nagy et al. 2014). However, circular dichroism
corresponding to the long-range order arrangement of the Chl-protein complexes,
namely, the arrays of the PSII-LHCII supercomplexes, was only reduced by
20% upon a transition to State 2 (Nagy et al. 2014). Therefore, 80% of the
PSII-LHCII supercomplex array was preserved during this transition. Neverthe-
less, the maximal room temperature fluorescence from PSII decreased signifi-
cantly. This decrease suggests that the energy absorbed by LHCIIs was dissipated
as heat, while they were physically associated with PSII (Nagy et al. 2014). Ünlü
and coworkers observed some increase of both amplitude and lifetime of the
fluorescence due to PSI, but it was indeed far smaller than that reported in the
literature (Delosme et al. 1996) and concluded that only a fraction of LHCII
recoupled to PSI under State 2 conditions and the rest of them stayed detached
and exhibited shortened excited state lifetime (Ünlü et al. 2014). By measuring
the electrochromic shift of the thylakoid pigments, which reflects a change in the
membrane potential due to charge separations, Nagy et al. also showed that the
enhancement of PSI antenna size during State 1 to State 2 transition was not
commensurate to the decrease in PSII antenna size (Nagy et al. 2014). On the
contrary, a more recent study by Nawrocki et al. demonstrated a larger increase in
the PSI antenna size (35%) and a smaller decrease in the PSII antenna size
(38%) based on their measurements of the electrochromic shift, with which they
concluded that the PSI antenna size was commensurate with the decrease in the
PSII antenna size so that most of the mobile LHCII were recoupled to PSI
(Nawrocki et al. 2016). It is thus still controversial how much PSII and PSI
antenna size changes during state transitions, whether the changes in the two
antenna size were comparable and whether there is energy-quenching LHCIIs
under State 2 conditions.
The possibility of energy quenching within the phosphorylated LHCII was
previously suggested by monitoring the effects of state transitions on the lifetimes
of the LHCII fluorescence in the cells (Iwai et al. 2010). While the cells were in
State 1, the dominant component of the fluorescence lifetime was 170 ps, and it
shifted to 250 ps under State 2 conditions. Because this lifetime shift was not
observed in the stt7 mutant, which is incapable of state transitions, and because the
142 J. Minagawa
Fig. 3 A model for the remodeling of the photosynthetic supercomplexes in the thylakoid
membranes during state transitions in C. reinhardtii. Side views of the membrane planes showing
alterations in the thylakoid ultrastructure and photosystem supercomplex composition: State
1 (left): thylakoids are more stacked, and large arrays of PSII-LHCII supercomplexes reside in
the appressed regions. The periodicity of thylakoid membranes is well defined. PSI-LHCI
supercomplexes, Cyt bf, and ATP synthases are in the non-appressed regions. State 2 (right): a
number of LHCII proteins are phosphorylated, and the thylakoids are partially unstacked and
undulated. The periodicity of the thylakoid membranes is weak. Many of the phosphorylated
LHCIIs (red) are in the energy-quenching state and remain associated with PSII, so that a large
part of the PSII-LHCII supercomplex array is preserved. Some of the phosphorylated LHCIIs (red)
are aggregated, and in the energy-quenching state, the other phosphorylated LHCIIs are associated
with PSI-LHCI supercomplex. The unphosphorylated LHCIIs (blue) stay on PSII and act as light-
harvesting antenna for PSII
appearance of the 250 ps component was paralleled by the activation of LHCII

phosphorylation and the formation of LHCII aggregates, the 250 ps component was
ascribed to the aggregated phospho-LHCIIs in the thylakoid membranes in State
2. If the LHCIIs were simply dissociated from the PSII core and existing as free
form, the lifetime would be >1 ns.
In Fig. 3, the two possible types of state-transition events in C. reinhardtii are
illustrated; one is the canonical antenna migration-type state transition, and another is
the green algae-specific antenna quenching-type state transition. Although the former
type causes reduction and elevation of the excitation of PSII and PSI, respectively, the
latter type only causes reduction of the excitation of PSII. The LHCII migration
between the two photosystems explains a 10–20% reduction of the PSII light-
harvesting capacity in C. reinhardtii, where such biochemical evidence has been
reported previously (Kargul et al. 2005; Takahashi et al. 2006; Tokutsu et al. 2009);
green algae and vascular plants thus seem to share the antenna migration-type state
transition. The quenching-type state transition may explain why a large change in the
antenna size of PSII is often observed in C. reinhardtii (Delosme et al. 1996). The
reason why the quenching-type state transition was developed in green algae is not
clear at present. One might link these variances in the molecular mechanisms to the
variances in the platforms for the photosynthetic machineries, namely, thylakoid supra-
structures. It is well known that morphological domains of the thylakoid membranes
are different in vascular plants and most of green algae (Nevo et al. 2009). In vascular
plants, grana and stroma-lamellae regions are clearly separated. While 10–20 layers of
the thylakoid membranes are stacked in grana region, only a single or a few membrane
stacks are present in the stroma-lamellae region (Mustárdy and Garab 2003;
Mullineaux 2005; Shimoni et al. 2005). Many green algae have areas of appressed
thylakoid membranes, which we also call grana, but do not have the highly structured
multiple membrane layers as the grana in vascular plants (Bertos and Gibbs 1998;
Engel et al. 2015). It is thus plausible that variances in the molecular mechanism for
state transitions and the other photoacclimation events of photosynthetic machineries
could be due to such differences in the thylakoid supra-structures. These problems need
to be clarified in future studies.
2.3 Reorganization of the PSI Supercomplex During State

Transitions
Vascular plants without PsaH and PsaL (Lunde et al. 2000) and those without PsaO
(Jensen et al. 2004) are deficient in state transitions. Because these small PSI subunits
are located on the opposite side of the LHCI belt (Amunts et al. 2010; Qin et al. 2015)
(Fig. 1), they were hypothesized to constitute a binding site for the mobile LHCII(s).
Further information regarding the reorganization of PSI upon a transition from State
1 to State 2 was provided in a study on C. reinhardtii, wherein the PSI-LHCI-LHCII
supercomplex from the State 2 cells contained two minor monomeric LHCII proteins,
CP26 and CP29, and one major trimeric LHCII protein, LHCBM5, suggesting a pivotal
role for the minor monomeric LHCII in state transitions, at least in green algae
(Takahashi et al. 2006, 2014). The significance of the minor LHCII in state transitions
in C. reinhardtii was further supported by an RNA interference (RNAi) study in which
the level of CP29 or CP26 was individually reduced (Tokutsu et al. 2009). Both the
CP29 and CP26 RNAi mutants underwent reductions in the PSII antenna size during a
State 1-to-State 2 transition. However, the LHCIIs undocked from PSII did not
reassociate with PSI in the CP29-RNAi mutant. By contrast, the mobile LHCIIs in
the CP26-RNAi mutant did reassociate with PSI, such that a PSI-LHCI-LHCII
supercomplex could be visualized on a sucrose density gradient (Tokutsu et al. 2009).
These results thus clarified that CP29, but not CP26, is crucial for the classical
antenna migration-type state transitions in C. reinhardtii. The 2D structures of such a
PSI-LHCI-LHCII supercomplex were recently visualized by single-particle analysis of
electron micrographs in C. reinhardtii (Drop et al. 2014) and in A. thaliana (Galka et al.
2012), where two LHCII trimers/one LHCII monomer (in C. reinhardtii) and one
LHCII trimer (in A. thaliana) were found near the PsaH/I/L subunits.
144 J. Minagawa
3 qE Quenching
3.1 Introduction
In nature, unexpected increases in light intensity can lead to overexcitation of the

photosystems, resulting in the accumulation of harmful reactive oxygen species
(Li et al. 2009). Plants and algae have developed non-photochemical quenching
(NPQ) mechanisms that alleviate such photooxidative stress. Among these mech-
anisms, the rapid deexcitation of the light-harvesting antenna of PSII that thermally
dissipates excess light energy as heat is called qE quenching (Govindjee et al. 1967;
Murata and Sugahara 1969). This type of NPQ is dependent upon ΔpH across the
thylakoid membranes (Wraight and Crofts 1971), and its extent and kinetics are
affected by the accumulation of a xanthophyll zeaxanthin (Zx) (Demmig et al.
1987). Further genetic studies paved the way for elucidating the molecular mech-
anism of qE (Horton et al. 2008; Li et al. 2009; de Bianchi et al. 2010).
3.2 Xanthophylls
Zx is accumulated in the thylakoid membranes under HL conditions by reversible

de-epoxidation of violaxanthin (Vx) in a process called xanthophyll cycle (Yamamoto
et al. 1962), which is activated by the acidification of the thylakoid lumen (Demmig-
Adams and Adams III 1992; Demmig-Adams et al. 1996). The npq1 mutant, which is
deficient in the conversion of Vx into Zx, was reported first in C. reinhardtii (Niyogi
et al. 1997b) and then in A. thaliana (Niyogi et al. 1998). Unlike the plant-type enzyme
that catalyze the Vx-Zx conversion, the counterpart enzyme in C. reinhardtii is located
on the stromal side of the thylakoid membrane and seems to be evolved from an
ancient de-epoxidase that was present in the common ancestor of green algae and
plants (Li et al. 2016).
Because the overaccumulation of Zx elevates the level of qE in vascular plants
(Niyogi et al. 1998; de Bianchi et al. 2010), Zx has been attributed to a quenching site
for qE. Fleming and coworkers reported that energy dissipation occurs via charge
transfer between Chl-Zx in the thylakoids (Holt et al. 2005) and in the reconstituted
CP29 protein (Ahn et al. 2008). The increased Chl-Zx interaction was directly
correlated with qE in LHCII (Bode et al. 2009). The triplet-minus-singlet spectra
of carotenoids in leaves and the isolated LHC complexes showed a characteristic
redshift in the presence of Zx (Dall’Osto et al. 2012). However, Wachtveitl and
coworkers demonstrated that the presence of Vx or Zx cation radicals in LHCII
made no difference to the excitation lifetimes of Chls (Amarie et al. 2007). Alter-
natively, Zx (Johnson et al. 2011), together with PsbS (Kereiche et al. 2010), was
hypothesized to decrease the ordered semicrystalline arrays of PSII supercomplexes,
leading to an increase in the fluidity of the thylakoid membranes and the promotion
of the energy-dissipative aggregation of LHCIIs (Goral et al. 2012).
In contrast to the npq1 mutant of vascular plants, the npq1 mutant in
C. reinhardtii, which is a different allele as described above, showed only a minor
effect on qE, indicating a possibility that the majority of photoprotection can be
achieved without Zx in this alga (Niyogi et al. 1997a, b). Although the lack of the
plant-type Vx de-epoxidation activity showed little photoinhibition under HL con-
ditions, an additional mutation in npq1 that inhibits lutein synthesis (lor1) caused
severe photoinhibition, suggesting that lutein, a central structural component of
LHCIIs, largely contributes to qE quenching in C. reinhardtii (Niyogi et al. 1997a).
3.3 qE Effectors
The npq4 mutant, which is deficient in the rapid induction of qE despite the normal
xanthophyll cycle and normal lumenal acidification, has been reported in both
A. thaliana and C. reinhardtii, but the alleles were mapped to different gene—the
four-helix LHC family protein PsbS in A. thaliana (Li et al. 2000) and the three-
helix LHC family protein LHCSR3 in C. reinhardtii (Peers et al. 2009). Again, the
same phenotype with different genotypes indicates that plants and algae perform qE
quenching in different ways. In PsbS, although one Chl molecule was identified in
its crystal structure (Fan et al. 2015), all of the canonical pigment-binding sites
identified in the LHCII crystal structure (Liu et al. 2004) are not conserved. PsbS is
not stably associated with the PSII-LHCII supercomplex (Caffarri et al. 2009) but
shows stronger association with LHCII trimer upon monomerization under HL
conditions (Correa-Galvis et al. 2016a). Several lines of evidence suggested that
PsbS in A. thaliana controls the macro-organization of the thylakoid membranes
through acidification of the lumen (Kiss et al. 2008; Kereiche et al. 2010; Goral
et al. 2012). Such a membrane “phase transition” is thought to facilitate the
dissociation of several LHCII proteins, including CP24, CP29, and the LHCII
M-trimer from PSII (Betterle et al. 2009); moreover, their aggregation (Kiss et al.
2008; Johnson et al. 2011) likely allows for the conformational change within major
LHCII (Ruban et al. 2007) and/or minor LHCII (Ahn et al. 2008) to generate
energy-quenching site(s). Alternatively, Wilk and colleagues reported that PsbS
directly interacts with LHCII and induces energy dissipation (Wilk et al. 2013). A
further study on Chl lifetimes showed that PsbS does not affect the relaxation
dynamics of the Chl excited state but changes the amount and the initial induction
rate of quenching (Sylak-Glassman et al. 2014).
Although both Zx and PsbS are thought to be crucial for qE quenching in
vascular plants, the green alga C. reinhardtii does not express the PSBS protein
at least under normal conditions (Finazzi et al. 2006; Bonente et al. 2008), and a
mutant deficient in Vx de-epoxidase activity still exhibits qE quenching (Niyogi
146 J. Minagawa
et al. 1997a, b). The PSBS protein encoded in the genome of C. reinhardtii shares
45% identity over 180 amino acids with A. thaliana PsbS (Minagawa and
Takahashi 2004), including the putative pH-sensing Glu residues (Li et al. 2004).
Because PSBS is constitutively present even in LL-grown plants (Demmig-Adams
et al. 2006), it provides instant photoprotection for vascular plants when they are
shifted to HL. The activation of qE in C. reinhardtii, however, requires prolonged
exposure to HL (Niyogi et al. 1997b), suggesting that algae have a largely different
mechanism for qE induction.
The C. reinhardtii npq4 mutant was mapped to an “ancient” LHC protein,
LHCSR3 (Peers et al. 2009). The genes for LHCSR3 (Lhcsr3.1 and Lhcsr3.2),
formerly known as LI818 (Gagne and Guertin 1992), encode a 25–26 kDa integral
membrane protein whose expression was induced under HL (Richard et al. 2000),
low CO2 (Miura et al. 2004), or low iron (Naumann et al. 2007) conditions.
Although PsbS binds few pigments, LHCSR3 is capable of binding Chl a and b,
as well as xanthophylls (Bonente et al. 2011). A recombinant LHCSR3 polypeptide
reconstituted with Chls and xanthophylls dissipated excitation energy in a low-pH
buffer, suggesting that this protein is a quenching site in C. reinhardtii (Bonente
et al. 2011). In addition to this “HL-specialized” antenna protein involved in
quenching, genetic analysis in C. reinhardtii has led to the identification of other
LHCs related to quenching. Depletion of one of the major trimeric LHCII proteins,
LHCBM1, in the npq5 mutant decreased its capacity for thermal energy dissipation
(Elrad et al. 2002). There is also an LHCSR3 homologue, called LHCSR1
(Minagawa 2009). A recent study reported an intriguing feature of this protein,
which is not observed in LHCSR3, namely, LHCSR1 which acts as low-pH sensor,
whose small amount induces thermal dissipation of a large array of the excited
LHCII (Dinc et al. 2016). Furthermore, very recent studies detected a rapid and
transient expression of PSBS, suggesting this plant-type qE effector could also be
involved in the algal-type qE, but the details still need to be clarified (Correa-Galvis
et al. 2016b; Tibiletti et al. 2016).
3.4 Current Model for the Induction of qE Quenching

in C. reinhardtii
Recently, signal transduction pathway(s) for LHCSR3 expression have been

becoming clarified. Hippler and coworkers reported that a chloroplast-localized
calcium sensor protein (CAS) affected the HL-dependent LHCSR3 expression
(Petroutsos et al. 2011), where a knockdown mutant of CAS did not express
LHCSR3 under HL conditions unless a high concentration of calcium was
supplemented. They also found that calmodulin antagonist W7 inhibited the
HL-dependent accumulation of LHCSR3 (Petroutsos et al. 2011), suggesting that
HL-dependent LHCSR3 expression is mediated by calmodulin and/or calmodulin-

affected calcium transients. More recently, the gene expression of LHCSR3.1 and
LHCSR3.2 as well as LHCSR1 was studied by quantitative PCR, confirming that
transcription of all the three LHCSR genes was induced by HL (Maruyama et al.
2014). However, their sensitivities to the inhibitors varied. The expressions of
LHCSR3.1 and LHCSR3.2 were almost completely inhibited by an inhibitor of
photosynthesis, 3-(3,4-dichlorophenyl)-1,1-dimethylurea (DCMU), or W7,
whereas that of LHCSR1 was only partially inhibited by W7 and was insensitive
to DCMU (Maruyama et al. 2014). Furthermore, Petroutsos et. al. determined the
spectral requirement for the induction of LHCSR3 and figured out that blue light
sensing by phototropin is crucial together with photosynthetic electron transport
(Petroutsos et al. 2016). On the other hand, Ulm, Goldschmidt-Clermont and their
coworkers revealed that LHCSR1 was induced by UV-B by means of UVRB
(Allorent et al. 2016; Tilbrook et al. 2016). These studies on the LHCSR gene
expression indicate there is always a few hours before the LHCSR proteins are
expressed under HL conditions. The cells are thus inevitably exposed to HL without
qE quenching in the first few hours. C. reinhardtii cells can actually alleviate such
initial HL stress by operating state transitions (Allorent et al. 2013).
Although LHCSR3 is necessary to activate qE quenching in C. reinhardtii,
where and how the LHCSR3 protein contributes has remained unclear. A recent
study clarified where LHCSR3 is localized in the thylakoid membranes and how it
dissipates excess energy (Tokutsu and Minagawa 2013). By comparing the PSII-
LHCII supercomplex isolated from wild-type (WT) C. reinhardtii cells and that
from npq4, Tokutsu and Minagawa found LHCSR3 was present only in the PSII
supercomplex from HL-grown WT cultures and not in that from LL-grown WT or
HL-grown npq4. The purified PSII-LHCII-LHCSR3 supercomplex was in a high-
fluorescence (light-harvesting) state at a neutral pH (7.5). However, the complex
was in a low-fluorescence (energy-dissipative) state at pH 5.5 (Tokutsu and
Minagawa 2013). This switching from a light-harvesting state to an energy-
dissipative state was sensitive to dicyclohexylcarbodiimide (DCCD), a protein-
modifying agent specific to protonatable amino acid residues. The molecular site
of this pH switch was localized to the C-terminus of LHCSR3 (Liguori et al. 2013).
A possible model for the induction of qE quenching in C. reinhardtii would be,
(1) HL-induced expression of LHCSR3 gene, (2) association of LHCSR3 with the
PSII-LHCII supercomplex, and (3) a conformational change in the C-terminus
induced by lumenal acidification (Fig. 4).
148 J. Minagawa
Fig. 4 A model for the induction of qE quenching in C. reinhardtii. When C. reinhardtii cells are
exposed to HL for a few hours (a), the expression of LHCSR3 is induced (b). LHCSR3 (yellow) is
then associated with the PSII-LHCII supercomplex to form the PSII-LHCII-LHCSR3
supercomplex (c). Though the PSII-LHCII-LHCSR3 supercomplex is still in a light-harvesting
state under dark or LL conditions, the lumen of the thylakoid membranes was acidified under HL
conditions (d), which causes a conformational change in its C-terminal region (red; “H” denotes
protonation) (e) to transform it into energy-dissipative state. When DCCD binds to LHCSR3
(yellow; “D” denotes DCCD), the PSII-LHCII-LHCSR3 supercomplex is not protonated (f). The
crystal coordinates were obtained from the Protein Data Bank: PSII core, 3ARC; LHCII, 2NHW;
and PSI-LHCI supercomplex, 2WSC
Acknowledgments The work conducted in my laboratory was supported by the Japan Society for
the Promotion of Science and the Japan Science and Technology Agency.
References
Ahn TK, Avenson TJ, Ballottari M, Cheng Y-C, Niyogi KK, Bassi R, Fleming GR (2008)
Architecture of a charge-transfer state regulating light harvesting in a plant antenna protein.
Science 320:794–797
Allen JF (1992) Protein phosphorylation in regulation of photosynthesis. Biochim Biophys Acta
1098:275–335
Allorent G, Tokutsu R, Roach T, Peers G, Cardol P, Girard-Bascou J, Seigneurin-Berny D,
Petroutsos D, Kuntz M, Breyton C, Franck F, Wollman FA, Niyogi KK, Krieger-Liszkay A,
Minagawa J, Finazzi G (2013) A dual strategy to cope with high light in Chlamydomonas
reinhardtii. Plant Cell 25:545–557
Allorent G, Lefebvre-Legendre L, Chappuis R, Kuntz M, Truong TB, Niyogi KK, Ulm R,

Goldschmidt-Clermont M (2016) UV-B photoreceptor-mediated protection of the photosynthetic
machinery in Chlamydomonas reinhardtii. Proc Natl Acad Sci U S A 113:14864–14869
Amarie S, Standfuss J, Barros T, Kuhlbrandt W, Dreuw A, Wachtveitl J (2007) Carotenoid radical
cations as a probe for the molecular mechanism of nonphotochemical quenching in oxygenic
photosynthesis. J Phys Chem B 111:3481–3487
Amunts A, Toporik H, Borovikova A, Nelson N (2010) Structure determination and improved
model of plant photosystem I. J Biol Chem 285:3478–3486
Asada K (1999) The water-water cycle in chloroplasts: scavenging of active oxygens and dissipation of
excess photons. Annu Rev Plant Physiol Plant Mol Biol 50:601–639
Bellafiore S, Barneche F, Peltier G, Rochaix J-D (2005) State transitions and light adaptation
require chloroplast thylakoid protein kinase STN7. Nature 433:892–895
Bertos NR, Gibbs SP (1998) Evidence for a lack of photosystem segregation in Chlamydomonas
reinhardtii (Chlorophyceae). J Phycol 34:1009–1016
Betterle N, Ballottari M, Zorzan S, de Bianchi S, Cazzaniga S, Dall’Osto L, Morosinotto T, Bassi
R (2009) Light-induced dissociation of an antenna hetero-oligomer is needed for
non-photochemical quenching induction. J Biol Chem 284:15255–15266
Bode S, Quentmeier CC, Liao PN, Hafi N, Barros T, Wilk L, Bittner F, Walla PJ (2009) On the
regulation of photosynthesis by excitonic interactions between carotenoids and chlorophylls.
Proc Natl Acad Sci U S A 106:12311–12316
Boekema EJ, Hankamer B, Bald D, Kruip J, Nield J, Boonstra AF, Barber J, R€ ogner M (1995)
Supramolecular structure of the photosystem II complex from green plants and cyanobacteria.
Boekema EJ, Nield J, Hankamer B, Barber J (1998) Localization of the 23-kDa subunit of the
oxygen-evolving complex of photosystem II by electron microscopy. Eur J Biochem
252:268–276
Boekema EJ, Van Roon H, Van Breemen JF, Dekker JP (1999) Supramolecular organization of
photosystem II and its light-harvesting antenna in partially solubilized photosystem II membranes.
Eur J Biochem 266:444–452
Bonaventura C, Myers J (1969) Fluorescence and oxygen evolution from Chlorella pyrenoidosa.
Bonente G, Howes BD, Caffarri S, Smulevich G, Bassi R (2008) Interactions between the
photosystem II subunit PsbS and xanthophylls studied in vivo and in vitro. J Biol Chem
283:8434–8445
Bonente G, Ballottari M, Truong TB, Morosinotto T, Ahn TK, Fleming GR, Niyogi KK, Bassi R
(2011) Analysis of LhcSR3, a protein essential for feedback de-excitation in the green alga
Chlamydomonas reinhardtii. PLoS Biol 9:e1000577
Brocks JJ, Logan GA, Buick R, Summons RE (1999) Archean molecular fossils and the early rise
of eukaryotes. Science 285:1033–1036
Caffarri S, Kouril R, Kereiche S, Boekema EJ, Croce R (2009) Functional architecture of higher
plant photosystem II supercomplexes. EMBO J 28:3052–3063
Correa-Galvis V, Poschmann G, Melzer M, Stühler K, Jahns P (2016a) PsbS interactions involved
in the activation of energy dissipation in Arabidopsis. Nat Plants 2:15225
Correa-Galvis V, Redekop P, Guan K, Griess A, Truong TB, Wakao S, Niyogi KK, Jahns P
(2016b) Photosystem II subunit PsbS is involved in the induction of LHCSR-dependent energy
dissipation in Chlamydomonas reinhardtii. J Biol Chem 291(33):17478–17487
Dall’Osto L, Holt NE, Kaligotla S, Fuciman M, Cazzaniga S, Carbonera D, Frank HA, Alric J,
Bassi R (2012) Zeaxanthin protects plant photosynthesis by modulating chlorophyll triplet
yield in specific light-harvesting antenna subunits. J Biol Chem 287:41820–41834
Daum B, Nicastro D, Austin J II, McIntosh JR, Kühlbrandt W (2010) Arrangement of photosystem
II and ATP synthase in chloroplast membranes of spinach and pea. Plant Cell 22:1299–1312
150 J. Minagawa
de Bianchi S, Dall’Osto L, Tognon G, Morosinotto T, Bassi R (2008) Minor antenna proteins CP24
and CP26 affect the interactions between photosystem II subunits and the electron transport
rate in grana membranes of Arabidopsis. Plant Cell 20:1012–1028
de Bianchi S, Ballottari M, Dall’osto L, Bassi R (2010) Regulation of plant light harvesting by
thermal dissipation of excess energy. Biochem Soc Trans 38:651–660
Dekker JP, Boekema EJ (2005) Supramolecular organization of thylakoid membrane proteins in
green plants. Biochim Biophys Acta 1706:12–39
Delosme R, Olive J, Wollman F-A (1996) Changes in light energy distribution upon state
transitions: an in vivo photoacoustic study of the wild type and photosynthesis mutants from
Chlamydomonas reinhardtii. Biochim Biophys Acta 1273:150–158
Demmig B, Winter K, Kruger A, Czygan FC (1987) Photoinhibition and zeaxanthin formation in
intact leaves: a possible role of the xanthophyll cycle in the dissipation of excess light energy.
Demmig-Adams B, Adams WW III (1992) Photoprotection and other responses of plants to high
light stress. Annu Rev Plant Physiol Plant Mol Biol 43:599–626
Demmig-Adams B, Adams Iii WW, Barker DH, Logan BA, Bowling DR, Verhoeven AS (1996)
Using chlorophyll fluorescence to assess the fraction of absorbed light allocated to thermal
dissipation of excess excitation. Physiol Plant 98:253–264
Demmig-Adams B, Ebbert V, Mellman DL, Mueh KE, Schaffer L, Funk C, Zarter CR, Adamska I,
Jansson S, Adams WW (2006) Modulation of PsbS and flexible vs sustained energy dissipation
by light environment in different species. Physiol Plant 127:670–680
Depège N, Bellafiore S, Rochaix J-D (2003) Role of chloroplast protein kinase Stt7 in LHCII
phosphorylation and state transition in Chlamydomonas. Science 299:1572–1575
Dinc E, Tian L, Roy LM, Roth R, Goodenough U, Croce R (2016) LHCSR1 induces a fast and
reversible pH-dependent fluorescence quenching in LHCII in Chlamydomonas reinhardtii
cells. Proc Natl Acad Sci U S A 113:7673–7678
Drop B, Webber-Birungi M, Fusetti F, Kouril R, Redding KE, Boekema EJ, Croce R (2011)
Photosystem I of Chlamydomonas reinhardtii is composed of nine light-harvesting complexes
(Lhca) located on one side of the core. J Biol Chem 286:44878–44887
Drop B, Yadav KNS, Boekema EJ, Croce R (2014) Consequences of state transitions on the
structural and functional organization of photosystem I in the green alga Chlamydomonas
reinhardtii. Plant J 78:181–191
Elrad D, Niyogi KK, Grossman AR (2002) A major light-harvesting polypeptide of photosystem II
functions in thermal dissipation. Plant Cell 14:1801–1816
Engel BD, Schaffer M, Kuhn Cuellar L, Villa E, Plitzko JM, Baumeister W (2015) Native
architecture of the Chlamydomonas chloroplast revealed by in situ cryo-electron tomography.
elife 4:e04889
Fan M, Li M, Liu Z, Cao P, Pan X, Zhang H, Zhao X, Zhang J, Chang W (2015) Crystal structures
of the PsbS protein essential for photoprotection in plants. Nat Struct Mol Biol 22:729–735
Finazzi G, Johnson GN, Dall’Osto L, Zito F, Bonente G, Bassi R, Wollman F-A (2006)
Nonphotochemical quenching of chlorophyll fluorescence in Chlamydomonas reinhardtii.
Gagne G, Guertin M (1992) The early genetic response to light in the green unicellular alga
Chlamydomonas eugametos grown under light/dark cycles involves genes that represent direct
responses to light and photosynthesis. Plant Mol Biol 18:429–445
Galka P, Santabarbara S, Khuong TT, Degand H, Morsomme P, Jennings RC, Boekema EJ,
Caffarri S (2012) Functional analyses of the plant photosystem I-light-harvesting complex II
supercomplex reveal that light-harvesting complex II loosely bound to photosystem II is a very
efficient antenna for photosystem I in state II. Plant Cell 24:2963–2978
Goral TK, Johnson MP, Duffy CD, Brain AP, Ruban AV, Mullineaux CW (2012) Light-harvesting
antenna composition controls the macrostructure and dynamics of thylakoid membranes in
Arabidopsis. Plant J 69:289–301
Govindjee, Papageorgiou G, Rabinowitch E (1967) Chlorophyll fluorescence and photosynthesis.

In: Guilbault GG (ed) Fluorescence; Theory, instrumentation and practice. Marcel Dekker,
New York, pp 511–564
Haldrup A, Jensen PE, Lunde C, Scheller HV (2001) Balance of power: a view of the mechanism
of photosynthetic state transitions. Trends Plant Sci 6:301–305
Hankamer B, Nield J, Zheleva D, Boekema E, Jansson S, Barber J (1997) Isolation and biochemical
characterisation of monomeric and dimeric photosystem II complexes from spinach and their
relevance to the organisation of photosystem II in vivo. Eur J Biochem 243:422–429
Holt NE, Zigmantas D, Valkunas L, Li XP, Niyogi KK, Fleming GR (2005) Carotenoid cation
formation and the regulation of photosynthetic light harvesting. Science 307:433–436
Horton P, Johnson MP, Perez-Bueno ML, Kiss AZ, Ruban AV (2008) Photosynthetic acclimation:
does the dynamic structure and macro-organisation of photosystem II in higher plant grana
membranes regulate light harvesting states? FEBS J 275:1069–1079
Iwai M, Takahashi Y, Minagawa J (2008) Molecular remodeling of photosystem II during state
transitions in Chlamydomonas reinhardtii. Plant Cell 20:2177–2189
Iwai M, Yokono M, Inada N, Minagawa J (2010) Live-cell imaging of photosystem II antenna
dissociation during state transitions. Proc Natl Acad Sci U S A 107:2337–2342
Jansson S (1999) A guide to the Lhc genes and their relatives in Arabidopsis. Trends Plant Sci
4:236–240
Jensen PE, Haldrup A, Zhang S, Scheller HV (2004) The PSI-O subunit of plant photosystem I is
involved in balancing the excitation pressure between the two photosystems. J Biol Chem
279:24212–24217
Johnson MP, Goral TK, Duffy CD, Brain AP, Mullineaux CW, Ruban AV (2011) Photoprotective
energy dissipation involves the reorganization of photosystem II light-harvesting complexes in
the grana membranes of spinach chloroplasts. Plant Cell 23:1468–1479
Kargul J, Turkina MV, Nield J, Benson S, Vener AV, Barber J (2005) Light-harvesting complex II
protein CP29 binds to photosystem I of Chlamydomonas reinhardtii under State 2 conditions.
FEBS J 272:4797–4806
Kereiche S, Kiss AZ, Kouril R, Boekema EJ, Horton P (2010) The PsbS protein controls the
macro-organisation of photosystem II complexes in the grana membranes of higher plant
chloroplasts. FEBS Lett 584:759–764
Kiss AZ, Ruban AV, Horton P (2008) The PsbS protein controls the organization of the photosystem II
antenna in higher plant thylakoid membranes. J Biol Chem 283:3972–3978
Kouřil R, Oostergetel GT, Boekema EJ (2011) Fine structure of granal thylakoid membrane
organization using cryo electron tomography. Biochim Biophys Acta 1807:368–374
Kovács L, Damkjær J, Kereı̈che S, Ilioaia C, Ruban AV, Boekema EJ, Jansson S, Horton P (2006)
Lack of the light-harvesting complex CP24 affects the structure and function of the grana
membranes of higher plant chloroplasts. Plant Cell 18:3106–3120
Li XP, Bj€orkman O, Shih C, Grossman AR, Rosenquist M, Jansson S, Niyogi KK (2000) A
pigment-binding protein essential for regulation of photosynthetic light harvesting. Nature
403:391–395
Li XP, Gilmore AM, Caffarri S, Bassi R, Golan T, Kramer D, Niyogi KK (2004) Regulation of
photosynthetic light harvesting involves intrathylakoid lumen pH sensing by the PsbS protein.
J Biol Chem 279:22866–22874
Li Z, Peers G, Dent RM, Bai Y, Yang SY, Apel W, Leonelli L, Niyogi KK (2016) Evolution of an
atypical de-epoxidase for photoprotection in the green lineage. Nat Plants 2:16140
Li Z, Wakao S, Fischer BB, Niyogi KK (2009) Sensing and responding to excess light. Annu Rev
Plant Biol 60:239–260
Liguori N, Roy LM, Opacic M, Durand G, Croce R (2013) Regulation of light harvesting in the
green alga Chlamydomonas reinhardtii: the C-terminus of LHCSR is the knob of a dimmer
switch. J Am Chem Soc 135:18339–18342
Liu Z, Yan H, Wang K, Kuang T, Zhang J, Gui L, An X, Chang W (2004) Crystal structure of
spinach major light-harvesting complex at 2.72 Å resolution. Nature 428:287–292
152 J. Minagawa
Lunde C, Jensen PE, Haldrup A, Knoetzel J, Scheller HV (2000) The PSI-H subunit of photosystem I is
essential for state transitions in plant photosynthesis. Nature 408:613–615
Maruyama S, Tokutsu R, Minagawa J (2014) Transcriptional regulation of the stress-responsive light
harvesting complex genes in Chlamydomonas reinhardtii. Plant Cell Physiol 55:1304–1310
Minagawa J (2009) Light-harvesting proteins. In: Stern D, Harris EH (eds) Chlamydomonas
sourcebook. Springer, Amsterdam, pp 503–540
Minagawa J (2011) State transitions—the molecular remodeling of photosynthetic supercomplexes
that controls energy flow in the chloroplast. Biochim Biophys Acta 1807:897–905
Minagawa J, Takahashi Y (2004) Structure, function and assembly of photosystem II and its light-
harvesting proteins. Photosynth Res 82:241–263
Miura K, Yamano T, Yoshioka S, Kohinata T, Inoue Y, Taniguchi F, Asamizu E, Nakamura Y,
Tabata S, Yamato KT, Ohyama K, Fukuzawa H (2004) Expression profiling-based identification of
CO2-responsive genes regulated by CCM1 controlling a carbon-concentrating mechanism in
Moseley JL, Allinger T, Herzog S, Hoerth P, Wehinger E, Merchant S, Hippler M (2002)
Adaptation to Fe-deficiency requires remodeling of the photosynthetic apparatus. EMBO J
21:6709–6720
Mullineaux CW (2005) Function and evolution of grana. Trends Plant Sci 10:521–525
Murata N (1969) Control of excitation transfer in photosynthesis. I. Light-induced change of
chlorophyll a fluoresence in Porphyridium cruentum. Biochim Biophys Acta 172:242–251
Murata N, Sugahara K (1969) Control of excitation transfer in photosynthesis. III. Light-induced
decrease of chlorophyll a fluorescence related to photophosphorylation system in spinach
chloroplasts. Biochim Biophys Acta 189:182–192
Mustárdy L, Garab G (2003) Granum revisited. A three-dimensional model – where things fall into
place. Trends Plant Sci 8:117–122
Nagy G, Unnep R, Zsiros O, Tokutsu R, Takizawa K, Porcar L, Moyet L, Petroutsos D, Garab G,
Finazzi G, Minagawa J (2014) Chloroplast remodeling during state transitions in
Chlamydomonas reinhardtii as revealed by noninvasive techniques in vivo. Proc Natl Acad
Sci U S A 111:5042–5047
Naumann B, Busch A, Allmer J, Ostendorf E, Zeller M, Kirchhoff H, Hippler M (2007) Comparative
quantitative proteomics to investigate the remodeling of bioenergetic pathways under iron
deficiency in Chlamydomonas reinhardtii. Proteomics 7:3964–3979
Nawrocki WJ, Santabarbara S, Mosebach L, Wollman F-A, Rappaport F (2016) State transitions
redistribute rather than dissipate energy between the two photosystems in Chlamydomonas.
Nat Plants 2:16031
Nevo R, Chuartzman SG, Tsabari O, Reich Z, Charuvi D, Shimoni E (2009) Architecture of
thylakoid membrane networks. In: Wada H, Murata N (eds) Lipids in photosynthesis: essential
and regulatory functions. Springer, Doredrecht, pp 295–328
Nield J, Orlova EV, Morris EP, Gowen B, van Heel M, Barber J (2000a) 3D map of the plant
photosystem II supercomplex obtained by cryoelectron microscopy and single particle analysis.
Nat Struct Biol 7:44–47
Nield J, Kruse O, Ruprecht J, da Fonseca P, Büchel C, Barber J (2000b) Three-dimensional structure of
Chlamydomonas reinhardtii and Synechococcus elongatus photosystem II complexes allows for
comparison of their oxygen-evolving complex organization. J Biol Chem 275:27940–27946
Nield J, Redding K, Hippler M (2004) Remodeling of light-harvesting protein complexes in
Chlamydomonas in response to environmental changes. Eukaryot Cell 3:1370–1380
Nixon PJ, Michoux F, Yu J, Boehm M, Komenda J (2010) Recent advances in understanding the
assembly and repair of photosystem II. Ann Bot 106:1–16
Niyogi KK, Bj€orkman O, Grossman AR (1997a) The roles of specific xanthophylls in
photoprotection. Proc Natl Acad Sci U S A 94:14162–14167
Niyogi KK, Bj€orkman O, Grossman AR (1997b) Chlamydomonas xanthophyll cycle mutants
identified by video imaging of chlorophyll fluorescence quenching. Plant Cell 9:1369–1380
Niyogi KK, Grossman AR, Bj€ orkman O (1998) Arabidopsis mutants define a central role for the
xanthophyll cycle in the regulation of photosynthetic energy conversion. Plant Cell
10:1121–1134
Peers G, Truong TB, Ostendorf E, Busch A, Elrad D, Grossman AR, Hippler M, Niyogi KK (2009)
An ancient light-harvesting protein is critical for the regulation of algal photosynthesis. Nature
462:518–521
Petroutsos D, Busch A, Janssen I, Trompelt K, Bergner SV, Weinl S, Holtkamp M, Karst U, Kudla J,
Hippler M (2011) The chloroplast calcium sensor CAS is required for photoacclimation in
Petroutsos D, Tokutsu R, Maruyama S, Flori S, Greiner A, Magneschi L, Cusant L, Kottke T,
Mittag M, Hegemann P, Finazzi G, Minagawa J (2016) A blue-light photoreceptor mediates
the feedback regulation of photosynthesis. Nature 537:563–566
Qin X, Suga M, Kuang T, Shen J-R (2015) Structural basis for energy transfer pathways in the
plant PSI-LHCI supercomplex. Science 348:989–995
Richard C, Ouellet H, Guertin M (2000) Characterization of the LI818 polypeptide from the green
unicellular alga Chlamydomonas reinhardtii. Plant Mol Biol 42:303–316
Ruban AV, Wentworth M, Yakushevska AE, Andersson J, Lee PJ, Keegstra W, Dekker JP,
Boekema EJ, Jansson S, Horton P (2003) Plants lacking the main light-harvesting complex
retain photosystem II macro-organization. Nature 421:648–652
Ruban AV, Berera R, Ilioaia C, van Stokkum IH, Kennis JT, Pascal AA, van Amerongen H,
Robert B, Horton P, van Grondelle R (2007) Identification of a mechanism of photoprotective
energy dissipation in higher plants. Nature 450:575–578
Shimoni E, Rav-Hon O, Ohad I, Brumfeld V, Reich Z (2005) Three-dimensional organization of
higher-plant chloroplast thylakoid membranes revealed by electron tomography. Plant Cell
17:2580–2586
Stauber EJ, Fink A, Markert C, Kruse O, Johanningmeier U, Hippler M (2003) Proteomics of
Chlamydomonas reinhardtii light-harvesting proteins. Eukaryot Cell 2:978–994
Stauber EJ, Busch A, Naumann B, Svatos A, Hippler M (2009) Proteotypic profiling of LHCI from
Chlamydomonas reinhardtii provides new insights into structure and function of the complex.
Summons RE, Jahnke LL, Hope JM, Logan GA (1999) 2-Methylhopanoids as biomarkers for
cyanobacterial oxygenic photosynthesis. Nature 400:554–557
Sylak-Glassman EJ, Malnoe A, De Re E, Brooks MD, Fischer AL, Niyogi KK, Fleming GR (2014)
Distinct roles of the photosystem II protein PsbS and zeaxanthin in the regulation of light
harvesting in plants revealed by fluorescence lifetime snapshots. Proc Natl Acad Sci U S A
111:17498–17503
Takahashi H, Iwai M, Takahashi Y, Minagawa J (2006) Identification of the mobile light-harvesting
complex II polypeptides for state transitions in Chlamydomonas reinhardtii. Proc Natl Acad Sci U
S A 103:477–482
Takahashi H, Okamuro A, Minagawa J, Takahashi Y (2014) Biochemical characterization of
photosystem I associating light-harvesting complexes I and II isolated from State-2 cells of
Chlamydomonas reinhardtii. Plant Cell Physiol 55:1437–1449
Teramoto H, Ono T-A, Minagawa J (2001) Identification of Lhcb gene family encoding the light-
harvesting chlorophyll-a/b proteins of photosystem II in Chlamydomonas reinhardtii. Plant
Cell Physiol 42:849–856
Tibiletti T, Auroy P, Peltier G, Caffarri S (2016) Chlamydomonas reinhardtii PsbS protein is functional
and accumulates rapidly and transiently under high light. Plant Physiol 171:2717–2730
Tilbrook K, Dubois M, Crocco CD, Yin R, Chappuis R, Allorent G, Schmid-Siegert E, Goldschmidt-
Clermont M, Ulm R (2016) UV-B perception and acclimation in Chlamydomonas reinhardtii.
Plant Cell 28(4):966–983
Tokutsu R, Minagawa J (2013) Energy-dissipative supercomplex of photosystem II associated
with LHCSR3 in Chlamydomonas reinhardtii. Proc Natl Acad Sci U S A 110:10016–10021
154 J. Minagawa
Tokutsu R, Teramoto H, Takahashi Y, Ono T-A, Minagawa J (2004) The light-harvesting complex
of photosystem I in Chlamydomonas reinhardtii: protein composition, gene structures and
phylogenic implications. Plant Cell Physiol 45:138–145
Tokutsu R, Iwai M, Minagawa J (2009) CP29, a monomeric light-harvesting complex II protein, is
essential for state transitions in Chlamydomonas reinhardtii. J Biol Chem 284:7777–7782
Tokutsu R, Kato N, Bui KH, Ishikawa T, Minagawa J (2012) Revisiting the supramolecular
organization of photosystem II in Chlamydomonas reinhardtii. J Biol Chem 287:31574–31581
Ünlü C, Drop B, Croce R, van Amerongen H (2014) State transitions in Chlamydomonas
reinhardtii strongly modulate the functional size of photosystem II but not of photosystem
I. Proc Natl Acad Sci U S A 111:3460–3465
Vener AV, van Kan PJ, Rich PR, Ohad II, Andersson B (1997) Plastoquinol at the quinol oxidation site
of reduced cytochrome bf mediates signal transduction between light and protein phosphorylation:
thylakoid protein kinase deactivation by a single-turnover flash. Proc Natl Acad Sci U S A
94:1585–1590
Wilk L, Grunwald M, Liao PN, Walla PJ, Kuhlbrandt W (2013) Direct interaction of the major
light-harvesting complex II and PsbS in nonphotochemical quenching. Proc Natl Acad Sci U S
A 110:5452–5456
Wollman F-A, Lemaire C (1988) Studies on kinase-controlled state transitions in photosystem II
and b6f mutants from Chlamydomonas reinhardtii which lack quinone-binding proteins.
Wraight CA, Crofts AR (1971) Delayed fluorescence and the high-energy state of chloroplasts.
Yakushevska AE, Jensen PE, Keegstra W, van Roon H, Scheller HV, Boekema EJ, Dekker JP
(2001) Supermolecular organization of photosystem II and its associated light-harvesting
antenna in Arabidopsis thaliana. Eur J Biochem 268:6020–6028
Yamamoto HY, Nakayama TO, Chichester CO (1962) Studies on the light and dark interconversions
of leaf xanthophylls. Arch Biochem Biophys 97:168–173
Zito F, Finazzi G, Delosme R, Nitschke W, Picot D, Wollman F-A (1999) The Qo site of
cytochrome b6f complexes controls the activation of the LHCII kinase. EMBO J 18:2961–2969
Chlamydomonas: Anoxic Acclimation
and Signaling
Anja Hemschemeier
Abstract Chlamydomonas is a soil-dwelling freshwater alga that probably

encounters hypoxic or anoxic conditions frequently in its natural habitat. Its reper-
toire of fermentative enzymes is remarkably complex and flexible. Despite this
adaptability, at least under laboratory conditions, Chlamydomonas does not tolerate
dark anoxia very well. It appears to respond to this condition by a state of
quiescence, but still does not survive without light and molecular oxygen (O2)
longer than a couple of days. The amounts of hundreds of transcripts change in
anoxic algal cultures, but not much is known about the regulation of the anoxic
response in Chlamydomonas. The phenotypes of mutants deficient for one or the
other fermentative enzyme indicate a significant level of control by metabolic
signals, and a subset of genes is coordinately regulated in copper and O2 deficiency
by the copper response regulator1 (CRR1). However, the majority of genes that are
differentially expressed in anaerobic Chlamydomonas cells are regulated CRR1
independently. While details on O2 sensing in Chlamydomonas remain elusive,
principles and patterns begin to emerge, such as a possible influence of light and the
involvement of nitric oxide (NO) as a signaling molecule. This chapter summarizes
knowledge on the anoxic metabolism and its regulation in Chlamydomonas and
hypothesizes on putative signaling pathways based on existing reports and
observations.
Abbreviations
ACK Acetate kinase

ADH Alcohol dehydrogenase
ADH1, ADHE Bifunctional acetaldehyde-alcohol dehydrogenase
AMP, ADP, ATP Adenosine mono-, di-, triphosphate
ARC Amidoxime reducing component
A. Hemschemeier (*)
Faculty of Biology and Biotechnology, Department of Plant Biochemistry, Workgroup
Photobiotechnology, Ruhr-University of Bochum, Universitätsstr. 150, 44801 Bochum,
Germany

156 A. Hemschemeier
cGMP Cyclic guanosine monophosphate

CRR1 Copper response regulator 1
D-LDH D-Lactate dehydrogenase
FNR Fumarate and nitrate reduction (regulatory protein)
GK Glycerol kinase
G3P Glycerol-3-phosphate
GPD G3P dehydrogenase
GPP G3P phosphatase
HP Hypophosphite
L-NAME Nω-Nitro-L-arginine methyl ester
NAD(P)H Nicotinamide adenine dinucleotide (phosphate)
NIT1 Nitrate reductase (of Chlamydomonas)
NO Nitric oxide
NOS NO synthase
PAT Phosphate acetyltransferase
PDC Pyruvate decarboxylase
PEP Phosphoenolpyruvate
PFL Pyruvate-formate lyase
PflA PFL activase
PFR Pyruvate ferredoxin oxidoreductase
RNA-Seq RNA sequencing
ROS Reactive oxygen species
RNS Reactive nitrogen species
SAM S-adenosylmethionine
sGC Soluble guanylate cyclase
THB Truncated hemoglobin
1 Introduction
Approximately 2.3 billion years ago, molecular oxygen (O2) accumulated in the
Earth’s atmosphere (Bekker et al. 2004; Goldblatt et al. 2006), a process also known
as the “oxygen catastrophe.” It is widely accepted that the evolutionary invention of
oxygenic photosynthesis by early cyanobacteria was responsible for the emergence
of an oxygenated atmosphere (Lyons 2007; Buick 2008). Notwithstanding of being
the cause for one of the Earth’s mass extinction events, the accumulation of the
reactive and oxidizing gas is assumed to have allowed the evolution of complex
multicellular life forms (Hedges et al. 2004; Falkowski et al. 2005). One important
reason for this is the high energy yield of aerobic respiration. However, the
availability of the O2 molecule also resulted in the emergence of much more
complex biochemical networks (Raymond and Segre 2006) due to the evolution
of enzymes that utilize O2 as a substrate or reactant (Goldfine 1965; Raymond and
Blankenship 2004). Not least, reactive oxygen and nitrogen species (ROS, RNS)
Chlamydomonas: Anoxic Acclimation and Signaling 157
Fig. 1 Overview on important O2-dependent processes and their counterparts under anoxia that are
induced in the framework of acclimatory processes upon sensing and signaling the shortage of O2
that result from O2 chemistry are employed in signaling pathways as well as for
pathogen defense (Halliwell 2006; Thannickal 2009). The flip side of the coin is
that many higher eukaryotes that probably evolved with the help of O2 are now
dependent on the molecule. Most animals and higher plants are aerobes and cannot
survive O2 deficiency for an extended period of time. In contrast, facultative
anaerobes such as the bacterium Escherichia coli make use of the benefits of O2
in its presence, but they can also grow in its absence. In any case, when the O2
concentrations are below those needed for the normal operation of aerobic path-
ways (hypoxia) or in the complete absence of O2 (anoxia), the metabolism has to be
adjusted (Fig. 1). Many organisms can switch from aerobic to anaerobic respiration
and utilize electron acceptors other than O2 while still generating adenosine tri-
phosphate (ATP) through electron transport phosphorylation (Amend and Shock
2001; Ginger et al. 2010; Müller et al. 2012). In the absence of suitable electron
acceptors or in organisms incapable of anaerobic respiration, O2 deficiency induces
fermentation, during which ATP is generated through substrate-level phosphoryla-
tion, yielding much less energy compared to respiration. Additionally, fermentation
results in the accumulation and often secretion of reduced end products, because the
reducing equivalents [mostly reduced nicotinamide adenine dinucleotide (phos-
phate) (NAD(P)H)] that are produced during the oxidative degradation of the
substrate have to be reoxidized in order to allow a continuous substrate flow.
158 A. Hemschemeier
Generating sufficient energy while simultaneously maintaining a healthy equilib-

rium of the redox status, the pH, and potentially toxic end products such as ethanol
is a central issue of fermentation. Additionally, in anoxia, aerobes face the chal-
lenge of sustaining their repertoire of cellular components. For example, both the
biosynthesis and the degradation of tetrapyrroles include O2-dependent steps in
plants and algae (H€ortensteiner and Kräutler 2011; Tanaka et al. 2011), whereas
some bacterial species possess O2-independent enzymes for the same steps
(Brzezowski et al. 2015). The switch from aerobic to hypoxic or anaerobic metab-
olism can occur on the level of substrate fluxes. A well-known example is the
regulation of the glycolytic enzyme phosphofructokinase, which is activated by
adenosine diphosphate (ADP) and (in eukaryotes) inhibited by ATP (Sch€oneberg
et al. 2013). However, an important response to a shift from aerobic to anaerobic
conditions is the differential expression of hundreds of genes in most organisms
(Mustroph et al. 2010).
Oxygenic phototrophs produce O2 in the light, but they can encounter hypoxic or
anoxic conditions frequently. Higher plants can be challenged by O2 shortage
during floods and in water-logged soil (Bailey-Serres and Voesenek 2008).
Chlamydomonas reinhardtii (Chlamydomonas in the following) is a freshwater
alga and was often isolated from soil (Harris 2001). Its habitats tend to become
hypoxic due to the respiratory activity of surrounding organisms, especially in low
light or in darkness (Steunou et al. 2006). Chlamydomonas has long been used as a
model organism for studying plant or animal processes; however, not least the
research on its anaerobic metabolism has revealed that the microalga has its
particularities and is far from being only a model. This chapter will give an
overview about the anaerobic response of Chlamydomonas on the metabolic level
and about what is known about anoxic gene regulation. It should be noted that the
hypoxic or anaerobic response of Chlamydomonas is studied in different systems,
usually depending on the scientific question. Hypoxia in the light can be achieved
by purging illuminated cells with argon or nitrogen (N2) gas and is mostly applied
to study state transitions and cyclic electron flow (e.g., Terashima et al. 2012).
Starving illuminated Chlamydomonas cells for nutrients can result in endogenously
established hypoxia, and this system, which is mainly based on a decrease of
photosynthetic O2 evolution, is being studied extensively with regard to photobio
(techno)logical production of molecular hydrogen (H2) (e.g., Dubini and Ghirardi
2015) (also see chapter “Chlamydomonas: Hydrogenase and Hydrogen Produc-
tion”). The fermentative metabolism of the alga is usually analyzed in dark-anoxic
cells, for example, by purging a concentrated cell suspension with O2-free gas (e.g.,
Philipps et al. 2011) or by transferring a culture to sealed flasks in the dark, and let
the cells consume the dissolved O2 by respiratory activity, dubbed “self-
anaerobization” (Hemschemeier et al. 2013a). Here, mainly results from analyzing
dark-anoxic cells will be summarized, with references to other systems indicated.
2 The Anaerobic Metabolism of Chlamydomonas
Anaerobic respiration has not been described in Chlamydomonas, but it has a

surprisingly versatile and flexible repertoire of fermentative pathways (Atteia
et al. 2013; Catalanotti et al. 2013) (Fig. 2). According to the current state of
knowledge, this complexity makes Chlamydomonas stand out even from other
microalgae (Atteia et al. 2013). In contrast to plants and animals that usually resort
to ethanol or lactate homofermentation, the pattern of fermentative end products of
Chlamydomonas can best be described as a mixed acid fermentation. The major
compounds that are secreted by the wild type are formate, ethanol, and acetate
(Gfeller and Gibbs 1984; Kreuzberg 1984). This pattern is typical for a pyruvate
fermentation pathway initiated by pyruvate formate lyase (PFL) (EC 2.3.1.54).
Additionally, the gases carbon dioxide (CO2) and H2 are evolved in significant
quantities by anoxic Chlamydomonas cultures. D-Lactate, succinate, malate, and
glycerol are secreted to low amounts by wild-type algae (Gfeller and Gibbs 1984;
Kreuzberg 1984; Mus et al. 2007; Dubini et al. 2009), but can become major end
products in mutants (see below).
Glycerol Pi
+
NAD NADH Glucose
GPP ATP
ADP
GK G3P GPD DHAP
ADP Pi + NAD+ CO2
ATP NADH NADH NAD+
ATPADP
PEP PEPC
ADP ADP Oxaloacetate MDH
ATP
CO2
+ CO2 + ATP PYC FUM, FMR
H FDXOX
HYDA PFR Pyruvate MME Malate Succinate
H2 FDXred CoA
HYDEF PFL CO2 + NADH NAD+
HYDG NADH NAD+
PFLA
AcetylCoA Formate
Pi NADH NADH
PAT ADH1 PDC LDH
CoA NAD+ + CoA NAD
+
CO2
Acetylphosphate Acetaldehyde Acetaldehyde D-Lactate
ADP NADH
ACK ADH1
ATP NAD+
Acetate Ethanol
Fig. 2 Schematic overview on fermentative pathways of Chlamydomonas that are discussed in

the text. ACK acetate kinase, ADH1 acetaldehyde alcohol dehydrogenase (DH), DHAP dihydroxy-
acetone phosphate, FDX ferredoxin, FMR fumarate reductase, FUM fumarase, GK glycerol
kinase, G3P glycerol-3-phosphate, GPD G3P DH, GPP G3P phosphatase, HYDA [FeFe]-
hydrogenase, HYDEF, HYDG HYDA maturases, LDH lactate DH, MDH malate DH, MME
malic enzyme, PAT phosphate acetyltransferase, PDC pyruvate decarboxylase, PEP phospho-
enolpyruvate, PEPC PEP carboxylase, PFL pyruvate formate lyase, PFLA PFL activase, PFR
pyruvate ferredoxin oxidoreductase, PYC pyruvate carboxylase
160 A. Hemschemeier
2.1 Fermentation Through Pyruvate Formate Lyase
According to the pattern and amount of end products, PFL is the major fermentative
enzyme of wild-type Chlamydomonas cells. PFL is present in many prokaryotic and
some eukaryotic species (Stairs et al. 2011), and the enzyme from Escherichia coli is
well analyzed. PFL catalyzes the non-oxidative homolytic cleavage of pyruvate to
acetyl-CoA and formate and employs a glycyl radical and two conserved cysteines
(Cys) for this reaction (Buis and Broderick 2005 and references therein). The glycyl
radical is introduced into the PFL polypeptide posttranslationally by the radical S-
adenosylmethionine (SAM) enzyme PFL activase (PflA) (EC 1.97.1.4) (Buis and
Broderick 2005; Shisler and Broderick 2014) and makes the PFL enzyme sensitive
toward O2-induced cleavage at the site of the radical (Wagner et al. 1992).
In Chlamydomonas, besides the typical fermentation pattern, further results indi-
cating the activity of a PFL enzyme were enzyme assays using cell extracts
(Kreuzberg et al. 1987) and the fact that the formate analogue and mechanism-
based PFL inhibitor hypophosphite (HP) (Knappe et al. 1984) inhibits formate
secretion by the cells (Kreuzberg 1984). On the transcript and protein level,
Chlamydomonas PFL was first described 2006 (Atteia et al. 2006). PFL activity
was confirmed on the biochemical level using the recombinant protein, and the algal
PFL1 gene (Cre01.g044800) is able to complement an E. coli pfl mutant
(Hemschemeier et al. 2008). To date, the Chlamydomonas PflA has only been
identified on the transcript level (Atteia et al. 2006; Hemschemeier et al. 2008)
(GenBank: AAW32935, AJ620192).
The algal PFL1 was detected in the chloroplast and the mitochondrial fraction
both on the activity (Kreuzberg et al. 1987) and the protein level (Atteia et al. 2006;
Terashima et al. 2010). As only a single PFL-encoding gene can be found in the
alga’s genome, the enzyme appears to be dually targeted, probably by the approx-
imately 70-amino acid-long N-terminus which has no homology to bacterial
enzymes and which is dispensable for catalytic activity (Hemschemeier et al.
2008). It is noteworthy that although the PFL fermentation system of
Chlamydomonas is highly similar to that of E. coli, the microalga does not appear
to reutilize formate in a similar way. E. coli reimports formate and converts it into
H2 and CO2 via the formate hydrogen lyase (FHL) complex (Sawers 2005), which
is not present in Chlamydomonas. In fermenting Chlamydomonas cells, formate
does not accumulate intracellularly (Hemschemeier et al. 2008), but in the medium
(Gfeller and Gibbs 1984; Kreuzberg 1984).
The second product of PFL, acetyl-CoA, can be converted either to acetate,
allowing the additional production of ATP via substrate-level phosphorylation, or
to ethanol, resulting in the reoxidation of two NAD(P)H molecules (Fig. 2). For the
former reaction, Chlamydomonas most likely employs phosphate acetyltransferase
(PAT; EC 2.3.1.8) and acetate kinase (ACK; EC 2.7.2.1) like many prokaryotes
(Wolfe 2005). The microalga contains two genes for each enzyme. ACK1 (Cre09.
g396700) and PAT2 (Cre09.g396650) lie directly adjacent on chromosome
9, while ACK2 (Cre17.g709850) and PAT1 (Cre17.g699000) lie separated on
chromosome 17. ACK1 and PAT2 are chloroplast localized; ACK2 and PAT1
were detected in the mitochondria (Atteia et al. 2009; Terashima et al. 2010; Yang
et al. 2014). For the acclimation of Chlamydomonas to anoxia in the dark, the
chloroplast system might be more important: ack1 and pat2 mutants show a
slightly reduced survival after prolonged dark-anoxic incubation when compared
to the wild type or an ack2 mutant, and only mutations in the ack1 or pat2 genes
result in significantly reduced acetate secretion (Yang et al. 2014). Notably, even
an ack1ack2 double mutant still secretes acetate, suggesting the presence of
additional pathways of acetate formation from acetyl-CoA (Atteia et al. 2013;
Yang et al. 2014).
Ethanol production from acetyl-CoA requires acetaldehyde dehydrogenase
(EC 1.2.1.10) and alcohol dehydrogenase (ADH; EC 1.1.1.1) activity. In E. coli,
both activities lie on one single polypeptide, the AdhE protein, whose ADH domain
belongs to the iron (Fe)-containing ADHs (Kessler et al. 1991). Chlamydomonas
possesses at least one protein with high homology to the E. coli AdhE (ADH1;
Cre17.g746997) (Atteia et al. 2006) which is constitutively present (Hemschemeier
et al. 2008; Magneschi et al. 2012) although it might be as O2 sensitive as other
Fe-containing ADHs (Cabiscol et al. 1994; Echave et al. 2003). Chlamydomonas
possesses additional Fe-binding ADHs and also homologues to zinc (Zn)-
containing ADHs; however, an adh1 mutant does not secrete detectable amounts
of ethanol, indicating that ADH1 is the only (fermentatively) active ADH of the
alga (Magneschi et al. 2012).
2.2 Pyruvate Oxidation by Pyruvate Ferredoxin

Oxidoreductase
Chlamydomonas also contains a pyruvate ferredoxin oxidoreductase (PFR, often

also abbreviated as PFOR; EC 1.2.7.1) encoded by the gene Cre02.g095137. Like
PFL, PFR enzymes are mostly found in prokaryotes and some protists (Atteia et al.
2006; Hug et al. 2010). PFR decarboxylates pyruvate and converts it to acetyl-CoA,
reducing ferredoxin or flavodoxin at the same time (Fig. 2). PFR enzymes contain
three [4Fe4S] clusters and thiamine pyrophosphate (TPP) (Chabrière et al. 1999;
Ragsdale 2003). In vitro, several PFR proteins can utilize other keto acids than
pyruvate, such as 2-oxobutyrate or α-ketoglutarate (Meinecke et al. 1989; Fukuda
et al. 2001; Park et al. 2006). Chlamydomonas PFR was analyzed in the recombi-
nant form and has characteristics typical for the bacterial enzymes: it contains FeS
clusters and a TPP radical, is able to reduce ferredoxins, and is O2 sensitive as most
PFR proteins analyzed so far (Noth et al. 2013; van Lis et al. 2013). In several
anaerobic parasitic protists such as Trichomonas vaginalis or Tritrichomonas
foetus, reduced ferredoxin is reoxidized by hydrogenases which utilize the electrons
to form H2 (Müller et al. 2012; Makiuchi and Nozaki 2014). Chlamydomonas, as
162 A. Hemschemeier
many prokaryotes, some anaerobic protists, and other species of unicellular green
algae (Vignais and Billoud 2007; Peters et al. 2015), contains hydrogenases of the
[FeFe] type (also see chapter “Chlamydomonas: Hydrogenase and Hydrogen Pro-
duction” on hydrogenases and hydrogen production). The isoform HydA1 and
probably also the isoform HydA2 are located in the chloroplast (Happe et al.
1994; Forestier et al. 2003; Terashima et al. 2010). HydA1 accepts electrons from
reduced ferredoxin and thereby from photosynthetic electron transport (Winkler
et al. 2009; Hemschemeier and Happe 2011; Ghysels et al. 2013). During fermen-
tation in the dark, Chlamydomonas evolves relatively low but significant amounts
of H2 (Gfeller and Gibbs 1984; Kreuzberg 1984; Philipps et al. 2011), probably
through the reaction catalyzed by PFR: in vitro, a coupled enzyme assay including
Chlamydomonas PFR, ferredoxin, and HydA1 and the substrates pyruvate and
coenzyme A evolves H2 (Noth et al. 2013) (Fig. 2). Notably, also oxaloacetate,
but not α-ketoglutarate, can be utilized by the algal PFR besides pyruvate.
Whether the PFR-ferredoxin-HydA1 pathway operates in vivo is not clear yet, as
no pfr1 mutant has been published to date. Because PFR and PFL utilize the same
substrate, it was hypothesized that reduced PFL activity would enhance pyruvate
turnover by PFR and thus ferredoxin reduction and H2 production. However,
analyses in different laboratories and of different strains yielded conflicting results:
H2 production in darkness was higher in a pfl1 mutant and the HP-treated wild type
in one study (Philipps et al. 2011), but lower in allelic pfl1 mutants (Catalanotti
et al. 2012) or after HP treatment of the wild type in another study (Kreuzberg
1984). Catalanotti et al. (2012) suggested the higher CO2 and ethanol levels
determined in pfl1 mutant cultures to be due to pyruvate decarboxylase (PDC; EC
4.1.1.1) (Fig. 2). Indeed, Chlamydomonas has PDC activity (Kreuzberg et al. 1987),
and a protein of the expected size can be detected using an antibody against Pisum
sativum PDC (Hemschemeier et al. 2008). PDC is probably encoded by the gene
PDC3 (Cre03.g165700) whose product is localized in the cytosol (Burgess et al.
2016). In the pfl1 mutant described by Catalanotti et al. (2012), the PDC3 transcript
is higher abundant than in the wild type, while PFR transcript and PFR protein are
less abundant. Because the only ethanol producing fermentative enzyme of
Chlamydomonas is probably the ADH1 enzyme (see above, Magneschi et al.
2012), it would also have to oxidize the acetaldehyde produced by PDC. AdhE
enzymes indeed are able to convert acetaldehyde directly (Kessler et al. 1991;
Bruchhaus and Tannich 1994), and the pfl1 mutant has higher ADH1 transcript
levels (Catalanotti et al. 2012).
The different experimental outcomes regarding H2 evolution might be
explained by different incubation conditions. Higher H2 yields in algae with
impaired PFL1 activity were observed in cells that were concentrated in full
medium (Philipps et al. 2011), while lower H2 yields were observed analyzing
allelic pfl1 mutants (Catalanotti et al. 2012) or the wild type treated with HP
(Kreuzberg 1984) that were both anaerobically incubated in buffer. The amounts
of PFR protein are indeed much lower in anoxic cells incubated in buffer versus
full medium (van Lis et al. 2013). Another factor might be that different
Chlamydomonas strains were analyzed. The community becomes increasingly
aware of the fact that Chlamydomonas strains isolated at different locations or
even the same strain kept for years in one or the other laboratory show genetic
and/or phenotypic differences that can be quite significant (Chochois et al. 2010;
Jang and Ehrenreich 2012; Flowers et al. 2015; Gallaher et al. 2015).
2.3 Fermentation in Chlamydomonas Is Flexible
To date, several Chlamydomonas mutants deficient for individual fermentative

enzymes have been discovered. Their examination revealed that the alga is capable
to adjust its fermentative metabolism, usually secreting another end product in
higher amounts. For example, pfl1 mutants secrete no formate, more ethanol, and
less acetate than the wild type. Most interestingly, however, is the fact that these
mutants secrete significant amounts of D-lactate, which is usually hardly detectable
in the supernatant of wild-type cultures (Kreuzberg 1984; Philipps et al. 2011;
Burgess et al. 2012; Catalanotti et al. 2012). This indicates that constitutively
present D-lactate dehydrogenase activity (D-LDH; EC 1.1.1.28) (Husic and Tolbert
1985; Kreuzberg et al. 1987; Burgess et al. 2016) takes over and converts the
pyruvate that accumulates in cells with impaired PFL activity (Kreuzberg 1984)
(Fig. 2). Notably, Chlamydomonas transformants in which the gene for the protein
with the highest homology to D-LDH enzymes (gene LDH1, Cre07.g324550) is
posttranscriptionally downregulated still excrete wild-type amounts of D-lactate
upon inhibition of PFL1 with HP, suggesting either a high substrate flux through
LDH1 or alternative D-LDH generating pathways (Burgess et al. 2016).
An adh1 mutant, which does not secrete ethanol and which is therefore probably
incapable of utilizing acetyl-CoA for the reoxidation of NAD(P)H, also secretes
D-lactate, but additionally significant amounts of glycerol (Magneschi et al. 2012),
a fermentative end product usually not detected in Chlamydomonas wild-type
cultures (Gfeller and Gibbs 1984; Kreuzberg 1984). Fermentative glycerol gener-
ation might occur as in S. cerevisiae or T. vaginalis via glycerol-3-phosphate (G3P)
dehydrogenase (GPD; EC 1.1.1.8 or 1.1.1.94) which reduces dihydroxyacetone
phosphate to G3P and G3P phosphatase (GPP; EC 3.1.3.21) (Steinbüchel and
Müller 1986; Ansell et al. 1997; Påhlman et al. 2001). G3P could also be used by
glycerol kinase (GK; EC 2.7.1.30) to generate ATP (Fig. 2). In most organisms, GK
is utilized for the reverse reaction, because the thermodynamic equilibrium is in
favor of G3P production. However, the unicellular parasite Trypanosoma brucei
uses GK in anaerobiosis for ATP production (Hammond et al. 1985).
Chlamydomonas has several genes encoding putative GPDs as well as a GPP and
a GK gene, none of which are significantly upregulated on the transcriptional level
in the adh1 mutant (Magneschi et al. 2012).
164 A. Hemschemeier
Yet another strategy is employed by a de facto Chlamydomonas hydrogenase

mutant, in which the cofactor of the [FeFe]-hydrogenases cannot be assembled due
to a mutation in a gene encoding for the specific maturase HYDEF (Posewitz et al.
2004a) (also see chapter “Chlamydomonas: Hydrogenase and Hydrogen Produc-
tion”) and which is incapable of producing H2. The hydef mutant secretes less
formate, ethanol, and acetate, no CO2, but—again in contrast to the wild type—
succinate (Dubini et al. 2009). This mutant probably converts phosphoenolpyruvate
(PEP) or pyruvate to oxaloacetate or malate and then employs reverse reactions of
the tricarboxylic acid or glyoxylate cycle (Fig. 2). Some transcripts coding for
enzymes that would be involved in these reactions are indeed upregulated in the
hydef mutant, such as PEP carboxylase (EC 4.1.1.31), pyruvate carboxylase
(EC 6.4.1.1), malic enzyme (EC 1.1.1.38 or 1.1.1.40), fumarase (EC 4.2.1.2), and
fumarate reductase (EC 1.3.1.6) (Dubini et al. 2009).
It is noteworthy that many of the fermentative enzymes of Chlamydomonas are
located in the chloroplast (Happe et al. 1994; Atteia et al. 2006; Terashima et al.
2010; van Lis et al. 2013; Yang et al. 2014; Burgess et al. 2016), although some of
them are extremely O2 sensitive. Most analyses of the alga’s fermentative metab-
olism were conducted in dark-adapted and thus probably completely anoxic cells,
but H2 production and fermentation can also be observed under conditions of
nutrient deficiency in the light (Melis et al. 2000; Tsygankov et al. 2002; Winkler
et al. 2002; Hemschemeier et al. 2008; Philipps et al. 2012) which results in hypoxia
in sealed cultures mainly due to a decreased activity of photosystem II (PSII)
(Wykoff et al. 1998; Melis et al. 2000; Batyrova et al. 2012; Philipps et al. 2012;
Volgusheva et al. 2015). However, PSII remains active on a low level (e.g., Melis
et al. 2000; Philipps et al. 2012). It is unclear whether the O2-sensitive enzymes
such as the [FeFe]-hydrogenases, PFL, and PFR are protected from the photosyn-
thetically evolved O2, e.g., by O2-binding or O2-scavenging proteins, by compart-
mentalization, or by respiratory activities in- and outside the chloroplast (e.g.,
Steinbeck et al. 2015), or if they are destroyed but constantly resynthesized.
An induction on the transcript or protein level of some fermentative enzymes has
also been observed under conditions that are not typically associated with fermen-
tation. For example, the dual function alcohol/acetaldehyde dehydrogenase ADH1
shows a higher abundance under Fe deficiency in the light (Urzica et al. 2012;
H€ohner et al. 2013). The physiological significance of this was revealed in an adh1
mutant in which the typical responses of the photosynthetic apparatus to Fe
deficiency were less pronounced, while stress responses were enhanced, and it
was discussed that the ADH1 enzyme might be necessary to maintain the redox
poise of the chloroplast (H€ohner et al. 2013). Notably, ADH1 as well as PFL1 also
accumulate under copper (Cu) and Zn deficiency (Hsieh et al. 2013). Cu deficiency
does not result in reduced photosynthetic activity in the Chlamydomonas wild type
(see Sect. 3.2), but the HYDA1 and PFR1 genes are also induced on the transcrip-
tional and protein level under this condition (Castruita et al. 2011; Hsieh et al.
2013).
2.4 Anaerobic Survival of Chlamydomonas
Most higher plants or their organs are not very tolerant against hypoxia or anaero-
biosis (e.g., Drew 1997; Fukao and Bailey-Serres 2004; Bailey-Serres and
Voesenek 2008). The plenty of fermentative routes of Chlamydomonas and the
flexibility of the alga in dealing with the failure of fermentative subsystems should
indicate that the microalga can thrive well in O2 deficiency. Furthermore, the
availability of a hydrogenase coupled to photosynthetic electron transport helps
the alga to restart photosynthetic electron transport after dark-anoxic incubation,
which is also an important aspect of dealing with periods of anoxia in its natural
environment. HydA1 serves as a transient electron acceptor until sufficient amounts
of ATP are produced by linear and cyclic electron flow for the Calvin cycle to take
over as the major electron sink (Ghysels et al. 2013; Godaux et al. 2015). However,
Chlamydomonas does not grow under anoxic conditions unless supplied with light
(Graves et al. 1990; Hemschemeier et al. 2013a). Arrested growth in the dark is
accompanied by a significant decrease of the amounts of transcripts involved in
various aspects of cell growth and division (DNA biosynthesis, replication, and
structure, general transcription, and translation) (Hemschemeier et al. 2013a). This
response appears to be a “power save mode,” similar to the quiescence of several
plant species exposed to hypoxia (Bailey-Serres and Voesenek 2008). Whether or
how long this response can ensure the survival of Chlamydomonas in the long term
is not clear yet, because different observations were published. For example,
Magneschi et al. (2012) concentrated Chlamydomonas cell suspensions in buffer,
purged the suspension with argon, and then incubated them anoxically in the dark.
These cells, when dropped on agar plates and transferred back to light, showed
reduced growth already after 6 h and hardly any growth after 18 h of dark anoxia,
indicating that most of the cells died (Magneschi et al. 2012). After a similar
treatment, but concentration and incubation in high salt medium, the algal cells
showed a reduced growth only after 18 h of dark anoxia (Yang et al. 2014). In yet
another study, cells grew after several days of dark anaerobic incubation. Here,
cells were spotted on full medium agar plates, kept in an N2-H2 atmosphere in the
dark and then transferred back to normoxia (Whitney et al. 2011). The latter study
additionally indicated that the tolerance of the cells changed depending on the time
of day at which they were shifted to darkness and anoxia. After self-anaerobization
and transfer of the liquid cultures back to normoxia and light, cells incubated
without O2 in the dark for 24 h bleach, but green afterwards (Hemschemeier
2013). Even after 72 h of dark anoxia, cells green again, although this takes
considerably longer compared to cells treated for 24 h. Taken together, these results
show that many parameters influence the vitality of Chlamydomonas under O2
deprivation in the dark, such as nutrient availability, cell density, time of day, and
maybe also the speed at which anaerobiosis sets in.
166 A. Hemschemeier
3 O2-Responsive Gene Expression in Chlamydomonas
Transcripts of several genes that code for enzymes known to be involved in the
anaerobic metabolism of Chlamydomonas accumulate under anoxic conditions,
such as HYDA1 and HYDA2 (Happe and Kaminski 2002; Forestier et al. 2003),
PFR (Mus et al. 2007; Catalanotti et al. 2012), or PFL1 (Atteia et al. 2006). In case
of the hydrogenases (Happe and Kaminski 2002; Forestier et al. 2003) and PFR
(Catalanotti et al. 2012; van Lis et al. 2013), this transcriptional induction is
accompanied by an accumulation of protein, while the amounts of PFL1 protein
stay rather constant (Atteia et al. 2006; Catalanotti et al. 2012; Magneschi et al.
2012). It is noteworthy, though, that in several studies, a double-band pattern can be
observed in PFL1 immunoblots testing cell extracts from anoxic cells, whereby an
additional, slightly lower band appears (Atteia et al. 2006; Catalanotti et al. 2012;
Magneschi et al. 2012). This band pattern would be consistent with an O2-induced
cleavage of the PFL polypeptide at the site of the glycyl radical (Wagner et al.
1992). Although this has not been analyzed on the biochemical level in
Chlamydomonas yet, one might speculate that PFL is regulated mostly on the
posttranslational level via its conversion from the inactive form to the glycyl-
harboring active enzyme.
In addition to results on individual known genes, transcriptomics applying
microarray or RNA sequencing (RNA-Seq) analyses have revealed that the abun-
dance of hundreds of transcripts changes in dark-hypoxic or dark-anoxic
Chlamydomonas cells (Mus et al. 2007; Dubini et al. 2009; Hemschemeier et al.
2013a). In the context of anoxic gene regulation, it is noteworthy that the results of
the independent transcriptome analyses revealed only a relatively small number
of genes that were similarly regulated in all studies. Although the utilization of
different technologies (microarray versus RNA-Seq) and possibly also the progress
of the Chlamydomonas genome annotation (Blaby et al. 2014) are probably in part
responsible for these differences, the different treatment of the algal cells (cell
suspensions concentrated in buffer and purged with argon versus self-
anaerobization) will certainly have contributed to the different outcomes. From
these studies, but also from single-gene analyses, one can assume that many
“anoxia-responsive” genes are not directly or not solely regulated by the absence
of the O2 molecule, but also by other factors (see below).
Many O2 sensing and signaling components are known from various organism
groups (Bien and Espenshade 2010; Bailey-Serres et al. 2012; Butler 2013; Green
et al. 2014; Taabazuing et al. 2014), but not much is known on the factors that
regulate anoxia-responsive genes in Chlamydomonas. Although the fermentative
enzymes of the microalga show clear homology to their counterparts in other
organism groups, the associated O2 sensors or transcription factors were in most
cases not identified in its genome. However, considering the large number of
“unknown” genes in Chlamydomonas, it might well be that a known principle
of O2 sensing is carried out by a protein with no or no clear homology to a known
O2 sensor.
3.1 Principles of O2 Sensing
In general, O2 sensors can be described to be direct or indirect sensors, depending

on if they interact with the O2 molecule or if they register a physiological conse-
quence of O2 deficiency. Known direct O2 sensors contain an O2-binding moiety
such as heme, a diiron center, or iron sulfur (FeS) clusters (Taabazuing et al. 2014).
A well-studied example for a direct O2 sensor is the FNR (fumarate and nitrate
reduction) transcription factor of E. coli, which harbors a [4Fe4S] cluster under
anaerobic and a [2Fe2S] cluster under aerobic conditions, while only the [4Fe4S]
protein can form homodimers and bind to its DNA target sequences (Green et al.
2014, and references therein). Most FeS clusters are sensitive toward O2 unless
protected by the protein (Imlay 2006), so although Chlamydomonas does not
contain a clear FNR homologue, an FeS protein without any homology to FNR
might carry out a similar function. PFL activase, whose active FeS cluster is only
formed under anaerobic conditions in E. coli (Yang et al. 2009), might be such a
protein, although it would probably be responsible for activating the PFL
protein only.
Another direct O2 sensor is FixL which is part of a two-component system in
diazotrophic bacteria. It consists of a histidine kinase and a heme-binding PAS (Per
Arnt Sim) domain. Under microaerobic or anoxic conditions, when no O2 molecule
binds to the heme group, the kinase is activated and phosphorylates the response
regulator FixJ (Rodgers and Lukat-Rodgers 2005). Nine putative heme-binding
homologues of the FixL PAS domain were identified in Chlamydomonas, and two
of these, when analyzed in their recombinant forms, bind O2 with low affinity,
making them plausible candidates for O2 sensors (Murthy et al. 2012). In dark-
anoxic algal cells, several transcripts encoding PAS domain containing proteins
accumulate, among them FXL5 (Cre08.g373200) that was shown by Murthy et al.
(2012) to bind heme and O2 (Mus et al. 2007; Hemschemeier et al. 2013a). To date,
it is not known if these proteins are involved in regulating the anoxic response of
Chlamydomonas. They are all transmembrane proteins, but lack further domains
clearly hinting to a function (e.g., a kinase domain) (Murthy et al. 2012).
Indirect O2 sensing registers the metabolic consequences of O2 deficiency. For
example, through redox reactions of Cys residues, the ArcB transmembrane sensor
kinase from E. coli, part of the ArcAB two component system, registers the redox
state of quinones and thereby indirectly the respiratory electron flow (Bueno et al.
2012 and references therein).
Somewhere in between direct and indirect O2 sensing are signals arising from
O2-dependent pathways. Several organisms make a virtue out of necessity and
utilize the inability of O2-dependent enzymes to carry out catalysis as means of
sensing the O2 status. The readout can be the product of a biosynthetic pathway
that involves O2-dependent steps or the direct modification of an effector. In
S. cerevisiae, the cellular heme concentration decreases in anoxia (Zagorec and
168 A. Hemschemeier
Labbe-Bois 1986; Hon et al. 2003). Heme levels are registered by the transcrip-
tion factor Hap1p that activates genes involved in the aerobic metabolism only in
a heme-bound state (Zhang et al. 1998; Mense and Zhang 2006). In the fission
yeast Schizosaccharomyces pombe and other fungi, an SREBP (sterol regulatory
element-binding protein) transcription factor activates various genes involved in
the hypoxic response when sterol and O2 levels are low (Todd et al. 2006; Lee
et al. 2009; Bien and Espenshade 2010; Butler 2013). S. pombe cannot take up
sterols from the environment and is thus dependent on its de novo biosynthesis,
which is impaired in anoxia (Hughes et al. 2005). In metazoa, a central transcrip-
tion factor of the hypoxic response is the hypoxia-inducible factor 1 (HIF1), a
heterodimeric transcription factor consisting of HIF1α and HIF1β. Regulation
occurs to a large extent by stabilization of HIF1α. Although the regulation of
HIF1α is very complex and occurs on various levels (Fábián et al. 2016), one
major regulatory step is carried out by prolyl-4-hydroxylases. These enzymes
O2-dependently hydroxylate specific residues of the HIF1α polypeptide (Willam
et al. 2004), which is thereby targeted for proteasomal degradation (Robinson and
Ohh 2014). The HIF1α hydroxylases have a relatively low affinity for O2,
resulting in reduced hydroxylation activity in hypoxia and a stabilization of
HIF1α which then becomes available for activating genes involved in the hypoxic
metabolism (Semenza 2004, 2012).
In Arabidopsis, group VII ethylene-responsive factors (ERFs) are redundantly
involved in hypoxic gene expression and are stabilized in hypoxia (Bailey-Serres
et al. 2012; van Dongen and Licausi 2015). These ERFs are regulated through the
N-end rule, which refers to the lifetime of proteins in dependence of their
N-terminal amino acid. Several group VII ERFs feature a conserved N-terminal
sequence (MCGGAI) with a Cys directly following the methionine (Met). The Met
residue is probably constitutively removed by a Met aminopeptidase, exposing the
reactive Cys residue and allowing its O2-dependent conversion to sulfinic acid by
Cys dioxygenases (Weits et al. 2014). This is in turn recognized by an
arginyltransferase, and the arginylated N-terminus is a target for the protein degra-
dation pathway (Bailey-Serres et al. 2012; van Dongen and Licausi 2015).
In dark-anoxic Chlamydomonas cultures, more than 30 transcripts accumulate
that code for O2-dependent enzymes, including O2-dependent tetrapyrrole biosyn-
thetic enzymes and prolyl-4-hydroxylases (Mus et al. 2007; Hemschemeier et al.
2013a), indicating that pathways that depend on the O2 molecule are responsive to
anoxia on the gene regulatory level. However, Chlamydomonas lacks clear homo-
logues of the well-studied executing regulators Hap1p, SREBP, or HIF1α. The alga
contains at least 20 APETALA2/ethylene-responsive element-binding protein-
domain transcription factors (Dietz et al. 2010, plus own BlastP analyses on
Phytozome), but according to the current annotation, none starts with the conserved
MCGGAI motive or has a Cys at the second position. Obviously, if
Chlamydomonas makes use of this type of O2 sensing, the actual signal transducing
components are different.
3.2 Shared Anoxia and Copper-Responsive Gene Expression
To date, there is only one relatively well-studied example of an “anoxia-respon-

sive” transcription factor, which, however, was initially discovered due to its
essential role in the acclimation of Chlamydomonas to Cu deficiency. It was
noted that several genes that are induced upon Cu deficiency are also induced by
a lack of O2 and that both responses share signal transduction components and
require the same genetic locus (Wood 1978; Quinn et al. 2000, 2002). The respon-
sible transcription factor was termed copper response regulator 1 (CRR1) because
Chlamydomonas crr1 mutants hardly grow under Cu deficiency, whereas the wild
type grows well even if the growth medium is essentially Cu-free (Eriksson et al.
2004; Kropat et al. 2005). Similarly, Chlamydomonas grows well in an anoxic
atmosphere in the light, but the crr1 mutant does not (Eriksson et al. 2004;
Hemschemeier et al. 2013a). All responses of the wild type to a lack of Cu studied
to date are absent in the crr1 mutant, such as the replacement of the Cu-binding
soluble photosynthetic electron transport protein plastocyanin by the heme-protein
cytochrome c6 (CYC6) (Merchant and Bogorad 1986; Eriksson et al. 2004) or the
transcriptional induction of Cu transporter-encoding genes (Page et al. 2009).
3.2.1 The Principles of Gene Regulation by CRR1
The CRR1 transcription factor is a huge protein of 1232 amino acids which binds to
its target sequences through its SQUAMOSA promoter-binding protein (SBP)
domain (Kropat et al. 2005; Sommer et al. 2010), a plant-type DNA-binding
domain made of two Zn fingers (Yamasaki et al. 2004). The core DNA-binding
motive of SBP domain transcription factors is a highly conserved 50 -GTAC-30
sequence, but flanking nucleotides also play a role (Quinn et al. 2000, 2002;
Birkenbihl et al. 2005; Kropat et al. 2005; Liang et al. 2008). The transcriptional
activation of all Chlamydomonas CRR1 targets analyzed to date accordingly
depends on the presence of GTAC motives in their promoters, but the numbers
and positions of these target sites vary. The CYC6 core promoter (Quinn and
Merchant 1995) contains three GTAC motives, but only two of these confer
Cu-responsive gene expression and were therefore termed CuREs (copper response
elements). Notably, they can fulfil this function individually (i.e., mutations in one
of them do not abolish the expression of a reporter gene as long as the other one is
present) (Quinn et al. 2000). Two GTAC sites were analyzed in the promoter of the
gene encoding the aerobic coproporphyrinogen III oxidase CPX1, and only the
distal element allows Cu-responsive transcriptional activation (Quinn et al. 1999,
2000), while in the promoter of the Cu transporter encoding CTR1 gene, the
proximal of two analyzed GTAC sites is needed for Cu-dependent regulation
(Page et al. 2009). From the three GTAC motives present in the promoter of the
CRD1 gene coding for magnesium-protoporphyrin IX monomethyl ester (oxida-
tive) cyclase, two are required in concert for a significant expression of a reporter
170 A. Hemschemeier
gene under Cu deficiency (Allen et al. 2008), and the same is true for the promoter
of the gene encoding the ferredoxin isoform FDX5 (Lambertz et al. 2010). All of
the CuREs analyzed so far are also necessary for the induction of CRR1 target
genes under anaerobiosis; however, the transcriptional activation of the CPX1 gene
requires an additional GTAC motive, which was therefore termed HyRE (hypoxia
response element) (Quinn et al. 2002).
The varying positions and relevance of the GTAC motives show that CRR1
targets are not regulated by exactly the same mechanism. This notion was further
supported by ChIP (chromatin immunoprecipitation) and FAIRE (formaldehyde-
assisted isolation of regulatory elements) experiments that revealed that Cu defi-
ciency results in changes of the nucleosome occupancy and in histone modifications
in the promoters of the three CRR1 target genes CYC6, CPX1, and CRD1 (Strenkert
et al. 2011). The patterns were consistent with a loosening of the chromatin
structure, and significant changes were dependent on the wild-type CRR1 gene.
However, the results were distinct for each target gene and indicated that the DNA
of the CYC6 promoter is tightly packed (and thus essentially inactive) in the
non-induced state, while the CRD1 promoter is rather loosely packed even under
non-activating conditions and the status of the CPX1 promoter is somewhere in
between (Strenkert et al. 2011). This fits to transcript level analyses showing that
CYC6 mRNA cannot be detected by RNA hybridization analyses in non-induced
cells, whereas low amounts of CPX1 and CRD1 can (Merchant et al. 1991; Hill and
Merchant 1992; Quinn et al. 2002).
To date, additional putative CRR1 targets have been identified by comparing the
transcriptomes of crr1 mutants with those of the wild type in Cu (Castruita et al.
2011; Blaby-Haas et al. 2016) or O2 deficiency (Hemschemeier et al. 2013a).
Motive-enrichment analyses showed indeed an overrepresentation of GTAC sites
upstream of targets in Cu-depleted cells (Castruita et al. 2011). The CRR1 targets in
anoxic cells overlap only partially with those of Cu-deficient cells (Hemschemeier
et al. 2013a; Blaby-Haas et al. 2016), which might indicate distinct functions of
CRR1 under both conditions. However, the target genes remain to be analyzed in
detail. Furthermore, while the CRR1 targets mentioned above are essentially all-or-
nothing targets that are not activated at all in the crr1 mutant, there seem to be
intermediate responses, too, and those can get easily overlooked in RNA-Seq
analyses in which certain cutoffs have to be set.
So far, only one example for such an intermediate response has been analyzed.
Notably, this is the HYDA1 gene, which is induced in Cu-deficient cells, too,
resulting in an accumulation of transcript and protein (Castruita et al. 2011; Pape
et al. 2012; Hsieh et al. 2013). The involvement of CRR1 in HYDA1 regulation was
discovered by chance in a reporter gene screening for mutants affected in HYDA1
promoter activation under anoxia (Pape et al. 2012). The thereby identified allelic
crr1 mutant and the crr1 mutant originally isolated in the lab of Sabeeha Merchant
(Eriksson et al. 2004) have about half the amount of HYDA1 transcripts as well as
hydrogenase activity compared to the parental strains (Pape et al. 2012). The
HYDA1 promoter contains two GTAC sites, and a mutation of both is required to
reduce reporter gene activity to 50% under hypoxic conditions in the light, while
they appear to have a stronger impact in Cu-deficient cells (Pape et al. 2012). In
electrophoretic mobility shift assays, the SBP domain of CRR1 can bind the one
GTAC motive tested, and mercury ions inhibit HYDA1 gene induction (Pape et al.
2012). Mercury probably disturbs the binding of the CRR1 SBP domain to DNA
(Sommer et al. 2010) and inhibits the induction of several CRR1 targets (Hill et al.
1991; Quinn et al. 2002). HYDA1 transcript accumulation is less sensitive to
mercury than the CPX1 gene (Quinn et al. 2002), which is consistent with its partial
regulation by CRR1.
To date, the varying responses of CRR1 targets to limitations in Cu or O2 are not
understood. Most probably, CRR1 interacts with other proteins for a fine-tuning of
gene regulation. For example, the results regarding the chromatin and histone status
mentioned above suggest that CRR1 recruits histone modifying enzymes to its
target promoters (Strenkert et al. 2011). The size and architecture of the CRR1
polypeptide make such functions likely. With a length of ca. 80 amino acids, the
SBP domain constitutes only a small part of the protein. In its N-terminus, CRR1
has an AHA (aromatic, hydrophobic, acidic) domain which might be involved in
transcription transactivation in SBP box transcription factors from Arabidopsis and
Physcomitrella patens (Riese et al. 2007), but which does not appear to have an
essential function in CRR1 (Sommer et al. 2010). C-terminal of the SBP domain,
CRR1, and other SBP box factors feature a conserved domain which was termed
IRPGC domain according to highly conserved amino acids (Kropat et al. 2005;
Riese et al. 2007) and which might be involved in the homodimerization of
Arabidopsis SPL7 (Garcia-Molina et al. 2014). The C-terminus of CRR1 contains
ankyrin repeats which are often involved in protein-protein interactions (Mosavi
et al. 2004). CRR1 without ankyrin repeats restores growth, photosynthetic activity,
and CYC6 expression in the Cu-deficient crr1 mutant, but not CYC6 induction in
anaerobiosis (Sommer et al. 2010). It is therefore possible that CRR1 needs to form
homodimers or to interact with other proteins for CYC6 induction in anaerobiosis,
but not in Cu deficiency. At the very C-terminus of CRR1 lies a Cys-rich domain
which has similarities to metallothioneins and the Cu1+-binding domain of metal-
responsive transcription factor1 from Drosophila melanogaster (Kropat et al. 2005;
Sommer et al. 2010). Besides their role in coordinating metal ions, cysteines are
also known for their redox-related functions, and some anoxia-responsive sensors
indeed make use of the redox properties of Cys residues (Malpica et al. 2006;
Bueno et al. 2012). Therefore, the Cys-rich C-terminus of CRR1 is an interesting
candidate for both metal and anoxia sensing. Similar to the observations regarding
the CRR1 ankyrin repeats, the crr1 mutant equipped with a CRR1 protein without
the Cys-rich C-terminus (termed crr1ΔCys) shows restored growth, photosynthe-
sis, and CYC6 induction in the absence of Cu, but CYC6 transcript levels do not
change in anoxia. Additionally, in contrast to the wild type, this strain does hardly
accumulate Cu in O2 deficiency, but overaccumulates Zn under all conditions tested
(Sommer et al. 2010). The comparison of the transcriptomes of dark-anoxic crr1
mutants, crr1ΔCys strains, and the wild type showed that 23 of the anoxic CRR1
targets were not misregulated in crr1ΔCys strains, and in contrast to the crr1
mutant, the cells can grow in an anoxic atmosphere in the light, although not as
172 A. Hemschemeier
well as the wild type (Hemschemeier et al. 2013a). This indicates that the Cys-rich
C-terminus of CRR1 plays no essential and/or no O2-specific role in anoxia. It was
discussed that it is rather involved in sensing the Zn status, which is also connected
to the Cu availability (see below) (Sommer et al. 2010).
A noteworthy feature of the CRR1-mediated transcriptional response of
Chlamydomonas is its inducibility by nickel (Ni) ions. To date, no biological role
of Ni is known in the microalga, and its effects are thus probably pharmacological
(Quinn et al. 2003; Blaby-Haas et al. 2016). The comparison of the transcriptomes
of CRR1, crr1, and crr1ΔCys genotypes under Cu and O2 deficiency as well as Ni
addition revealed that the CRR1-dependent transcriptional response to Ni addition
is very similar to that to Cu deficiency, while its overlap with the hypoxia-
responsive transcriptome is significantly lower, again hinting to the involvement
of different additional factors (Blaby-Haas et al. 2016). Also, the Cys-rich C-ter-
minus of CRR1 seems to be needed for the most part of the Ni response, while its
role in the hypoxic response is less pronounced (Hemschemeier et al. 2013a; Blaby-
Haas et al. 2016). From their observations, Blaby-Haas et al. (2016) concluded that
Ni might interfere with a co-regulator of CRR1, which binds to the Cys-rich region.
Based on similarities to mammals, in which Ni inhibits the abovementioned prolyl-
4-hydroxylases, whose activity is also compromised by low O2 levels, it was
suggested that this co-regulator might be regulated by prolyl-4-hydroxylases in a
similar fashion as HIF1α (Blaby-Haas et al. 2016).
3.2.2 The Role of Coordinated Cu- and O2-Responsive Gene

Expression
RNA-Seq analyses showed that in dark-anoxic Chlamydomonas wild-type cells, the

amounts of over 400 transcripts changed at least fourfold (Hemschemeier et al.
2013a), while under Cu deficiency, the amounts of ca. 150 transcripts changed at
least twofold (Castruita et al. 2011; Blaby-Haas et al. 2016). This difference indicates
that the acclimation to Cu deficiency is less demanding for the cell than that to O2
deficiency, although the different timescales of the experiments have to be consid-
ered. Hemschemeier et al. (2013a) incubated the cells for 6 h while Castruita et al.
(2011) incubated them for several days, so the former study might have captured a
more transient and the latter study a more stationary transcriptome. Nevertheless, the
Chlamydomonas wild type grows undisturbed in the absence of Cu, while it seems to
tolerate dark anoxia less well (see above), suggesting that anoxia requires a more
drastic acclimation and results in more stress. Indeed, about 800 transcripts change in
the Cu-deficient crr1 mutant, and this higher number compared to the wild type was
interpreted to be a stress response (Castruita et al. 2011).
From the 150 transcripts whose amounts change significantly in Cu-deficient
cells, 83 were also differentially expressed in dark anoxia, and not all of these were
assigned CRR1 targets (Castruita et al. 2011; Hemschemeier et al. 2013a). The
biological reason for the coordinated response to Cu and O2 deficiency in
Chlamydomonas is still not known. The most obvious explanation lies in the
chemistry of Cu, which becomes reduced in anoxia and then tends to form insoluble
complexes that are hardly bioavailable. It would therefore make sense for an
organism to anticipate Cu deficiency in anoxia and vice versa. However, at least
in the laboratory, anoxic Chlamydomonas cells accumulate Cu (Sommer et al.
2010) and still produce plastocyanin holoprotein (Quinn et al. 2002), indicating
that the cells do not experience intracellular Cu shortage. Still, it seems plausible
that the oxidation state of the cellular Cu pool changes under anoxic conditions and
that this is registered by the Cu sensor (Quinn et al. 2002). This model is supported
by the observations that Cu2+ (present in aerobiosis) prevents the CRR1 SBP
domain from binding to its target sequence, but Cu1+ (probably present in anoxic
cells) does not (Sommer et al. 2010).
Another shared experience of Cu-depleted and anoxic cells is probably a change
in the overall metal status or its regulation. CRR1 is needed for a proper response to
Fe deficiency, probably via the biosynthesis of the Cu-containing ferroxidase FOX1
(La Fontaine et al. 2002; Eriksson et al. 2004; Chen et al. 2008). The responses of
Chlamydomonas to Cu and Zn deficiency are interwoven, too. Zn-depleted cells
overaccumulate Cu1+ in bodies similar to lysosomes, termed cuprosomes, in a
CRR1-dependent manner (Hong-Hermesdorf et al. 2014). These cells obviously
experience intracellular Cu deficiency, because CYC6 accumulates and the plasto-
cyanin amount decreases (Hong-Hermesdorf et al. 2014). In anoxia, the solubility
and thus likely the bioavailability of many metal ions change. For example, Zn and
molybdenum, like Cu, are less and manganese and Fe more soluble in low O2
environments (Anbar 2008). The abundance of several transcripts encoding com-
ponents of metal assimilation pathways change in dark-anoxic Chlamydomonas
cells (Hemschemeier et al. 2013a). Six thereof are also regulated under Cu defi-
ciency, and four (CTR1 to CTR3 and the putative Fe transporter-encoding gene
IRT2) are CRR1 targets. Yet another and, for the time being, speculative explana-
tion for the coordinated response to Cu and O2 deficiency might be the
compromised respiratory activity of both anoxic and Cu-deficient cells. While the
former lack the electron acceptor, the latter cannot fully maintain the synthesis of
the Cu-containing cytochrome c oxidase (Kropat et al. 2015).
In most cases, the physiological function of the enzymes encoded by Cu- and
O2-responsive genes remains elusive in at least one of the two conditions. For
example, the cytochrome c6 encoding CYC6 transcript accumulates strongly under
both conditions (Quinn et al. 2000), but whereas the function of CYC6 as a
replacement of plastocyanin under Cu deficiency is clear (Wood 1978; Eriksson
et al. 2004), its role in anoxia is not known, especially as anoxia does not result in a
degradation of plastocyanin (Moseley et al. 2000; Quinn et al. 2002). Two further
well-analyzed examples of coordinate expression under both Cu and O2 deficiency
are the CPX1 and the CRD1 genes (Hill and Merchant 1995; Quinn et al. 2000,
2002; Moseley et al. 2002b). CPX1 is an enzyme in the tetrapyrrole biosynthesis
pathway, CRD1 is part of the chlorophyll-specific branch, and the catalysis of both
enzymes is O2 dependent. It was suggested that under Cu deficiency, higher
amounts of CPX1 would allow the biosynthesis of sufficient amounts of heme for
the CYC6 protein. In hypoxia, it might be a strategy to catch the limited O2
174 A. Hemschemeier
molecules. In yeast, the corresponding gene HEM13 is also induced in hypoxia, and
the HEM13 protein is rate limiting under this condition (Zagorec and Labbe-Bois
1986; Zagorec et al. 1988). In case of CRD1, a physiological function under both
Cu and O2 deficiency has been shown, because crd1 mutants are chlorotic under
both conditions (Moseley et al. 2000, 2002b; Quinn et al. 2002). In Cu-free
medium, photosynthetic electron transport of the crd1 mutant is disturbed, and
the amounts of photosystem I (PSI) and light-harvesting complexes (LHC) I and II
are strongly reduced (Moseley et al. 2000, 2002b). Notably, CRD1 is expressed
reciprocally to the CTH1 gene, encoding an isoform that shares 67% identical
amino acids with CRD1 (Moseley et al. 2002b), but basal amounts of CRD1
transcript are also detected under standard growth conditions (in the presence of
Cu and O2), and the CRD1 protein has a constitutive function. Low-temperature
(77K) chlorophyll fluorescence emission spectra and isolation and characterization
of PSI complexes indicate that in crd1 mutants, the LHCI antennae are permanently
uncoupled from PSI (Moseley et al. 2002a, b). Because of the similarity of the
photosynthetic apparatus of the crd1 mutant in full medium to that of the wild type
under Fe deficiency, it was hypothesized that the CRD1 enzyme, which belongs to
the class of diiron-carboxylate proteins, plays a role in sensing the Fe status and
transmits this signal via chlorophyll biosynthesis and the PSI subunit PsaK to the
PSI-LHCI complex (Moseley et al. 2002a). Why higher amounts of CRD1 are
needed when Cu and O2 are limited is not known. A mutant deficient for light-
dependent protochlorophyllide reductase that has a similarly reduced chlorophyll
concentration as the Cu- or O2-deficient crd1 mutant does not exhibit a disturbed
chlorophyll fluorescence pattern in Cu-free medium (Moseley et al. 2000). A crd1
suppressor strain in which, contrary to the wild type, the CTH1 protein is present in
the absence of Cu and O2, is not chlorotic under these conditions, but 77K
chlorophyll fluorescence spectra are still different from those of the wild type
(Moseley et al. 2002b). These results indicate that CRD1 and CTH1 do not solely
function as chlorophyll biosynthetic enzymes but that they have other, only par-
tially overlapping roles.
As noted above, one of the shared targets of Cu and O2 deficiency is the HYDA1
gene. Notably, further genes encoding (O2-intolerant) enzymes known to be
involved in the anoxic metabolism of Chlamydomonas are induced on the transcript
and/or protein level in fully aerated Cu-deficient cells, such as the [FeFe]-
hydrogenase maturases HydEF and HydG, PFR, PFL1, or PAT2 (Castruita et al.
2011; Hsieh et al. 2013). Although this has not been analyzed yet, it is unlikely that
the extremely O2-sensitive HydA1 (Stripp et al. 2009) is active in aerated
Cu-deficient cells, unless there are protective mechanisms. The physiological role
of Cu- and O2-responsive genes becomes even more puzzling in view of recent
results about the ferredoxin encoding FDX5 gene. The gene is strongly induced in
anoxia and Cu deficiency (Mus et al. 2007; Jacobs et al. 2009; Terauchi et al. 2009;
Lambertz et al. 2010) and is a CRR1 target (Lambertz et al. 2010; Castruita et al.
2011; Hemschemeier et al. 2013a). Fdx5 is a plant-type [2Fe2S]-ferredoxin located
in the chloroplast (Jacobs et al. 2009; Terashima et al. 2010; Yang et al. 2015). In
in vitro enzyme assays, Fdx5 does not mediate NADPH photoproduction via
ferredoxin-NADP+ reductase, H2 production via HydA1, or pyruvate oxidation via

PFR (Jacobs et al. 2009; Noth et al. 2013; Peden et al. 2013; van Lis et al. 2013).
However, it seems to play a major and essential role under dark-oxic conditions,
probably as an electron donor to fatty acid desaturases (Yang et al. 2015). This
raises the question as to why the gene is so strongly induced by a lack of Cu and O2.
Several fatty acid desaturase transcripts are induced upon Cu limitations or anoxia,
some of them CRR1 dependently (Castruita et al. 2011; Hemschemeier et al.
2013a). In Cu-deficient cells, the induction of fatty acid desaturase genes is
accompanied by an increased desaturation level of several fatty acids in the wild
type but not in the crr1 mutant, and it was discussed that Cu-deficient cells need to
restructure their membranes (Castruita et al. 2011). In contrast, the general
desaturation status of the fatty acids in anoxic cells does not change significantly
(Hemschemeier et al. 2013a). This might be interpreted in a way that anoxic cells
also attempt to restructure their membrane fatty acid profile but cannot do so
because of the absence of the reactant O2, or that the O2-dependent fatty acid
desaturases are induced as a compensatory measure to catch the few available O2
molecules, or that the cells prepare for reoxygenation. The FDX5 gene, because of
its close physiological connection to fatty acid desaturases (Yang et al. 2015), might
be regulated due to the same reasons.
3.3 Potential Mechanisms of Indirect O2 Sensing

in Chlamydomonas
Roughly 10% of the transcriptional changes in dark-anoxic cells were assigned

CRR1 targets, showing that additional signal transduction pathways must be pre-
sent (Hemschemeier et al. 2013a). The (direct or indirect) O2 sensors or transcrip-
tion factors involved are not known yet, but in the following, several stimuli that are
plausible based on observations in dark-anoxic Chlamydomonas cells are discussed
(Fig. 3).
Metabolic signals can be concluded from the studies of Chlamydomonas mutants
deficient for individual fermentative enzymes. In Chlamydomonas pfl1 mutants,
some transcripts encoding fermentative enzymes accumulate differentially compared
to the wild type, especially HYDA1 and PFR (Philipps et al. 2011; Catalanotti et al.
2012). The mechanism behind this phenomenon is not known. A regulatory role of
formate as known from E. coli (Sawers 2005) is certainly possible, although exter-
nally added formate does not restore HYDA1 expression in Chlamydomonas
(Philipps et al. 2011) and the alga does not have a homologue of the E. coli
formate-binding transcription factor FhlA. In the hydef (de facto hydrogenase) mutant
that, in contrast to the wild type, secretes succinate under anoxic conditions, the
amounts of several transcripts are different from those in the wild type, too, such as
PFR, PFL1, and MME4 (Dubini et al. 2009). Several genes are also differentially
expressed in an adh1 mutant, especially the PFR gene (Magneschi et al. 2012).
176 A. Hemschemeier
Fig. 3 Schematic overview on possible ways of O2 sensing and signaling in Chlamydomonas that
are discussed in the text. Except for the known role of CRR1, the depicted processes and pathways
are deduced from mutant phenotypes or physiological observations and remain to be confirmed
and understood in molecular detail, respectively
Although the nature of the responsible signals remains to be elucidated, it is possible

that they originate from changes in the energy, redox, or metabolite status (Fig. 3).
In a eukaryotic photosynthetic organism, signals originating in the plastid are
well known to influence gene expression, such as intermediates of tetrapyrrole
and/or chlorophyll biosynthesis, metabolites, the redox state, or ROS (Fey et al.
2005; Kleine et al. 2009; Duanmu et al. 2013; Erickson et al. 2015). In
Arabidopsis, the gene regulatory responses to darkness, sucrose starvation, or
anoxia indeed overlap (Branco-Price et al. 2008; Schr€oder et al. 2011; Juntawong
and Bailey-Serres 2012). In dark-anoxic Chlamydomonas cells, the amounts of
several “photosynthetic transcripts” in the widest sense decrease, such as tran-
scripts coding for chlorophyll-binding proteins, chlorophyll biosynthetic enzymes,
or components of the carbon-concentrating mechanism (CCM) (Hemschemeier
et al. 2013a). However, many “photosynthetic transcripts” are generally lower in
darkness, independent from the presence or absence of O2, indicating that not
anoxia but darkness (or any metabolic consequence of the absence of light) is the
stimulus (Duanmu et al. 2013; Hemschemeier et al. 2013a; Zones et al. 2015).
Notably, several anoxia-responsive transcripts such as HYDA1, HYDA2, HYDEF,
and HYDG accumulate transiently in cells transferred to darkness in the presence of
O2, but their amounts decrease again upon prolonged dark-oxic incubation
(Hemschemeier et al. 2013a). Additional studies showed that HYDA1 and
HYDA2 (and further “fermentative”) transcript amounts are higher in dark- versus
light-incubated cells (Duanmu et al. 2013), and a diel rhythm in synchronized cells
can be observed (Whitney et al. 2011; Zones et al. 2015). However, it is not known
whether the genes are regulated by the circadian clock. Because the effect of
darkness is also seen in not synchronized cells (Duanmu et al. 2013;
Hemschemeier et al. 2013a), it is well possible that the photosynthetic activity
and the resulting O2 content of the cells (Whitney et al. 2011) influence the
expression of “anaerobic genes”. Experiments that utilized the PSII inhibitor
3-(3,4-dichlorophenyl)-1,1-dimethylurea (DCMU) to test the effect of a sudden
drop of photosynthetic O2 evolution resulted in mixed responses depending on the
target gene analyzed. While the HYDA1, HYDEF, and PFR transcripts did not
significantly respond to DCMU treatment of Chlamydomonas in the light and still
responded to darkness, other dark-responsive transcripts (e.g., of genes putatively
involved in amino acid catabolism) were strongly induced by DCMU in the light
(Hemschemeier et al. 2013a). This suggests that different stimuli are responsible
for the dark-induced accumulation of different subsets of transcripts, such as the
relative O2 content, the redox potential, or the carbohydrate or energy status
(Fig. 3). The Chlamydomonas HYDA1 gene can be induced in aerobic cells by
adding the monothiol reductant β-mercaptoethanol to the cells (Hemschemeier
et al. 2013a), HydA1 amounts are lower in the anaerobic response 1 (anr1)-
deficient mutant impaired in cyclic electron flow under anoxic conditions
(Terashima et al. 2012), and HYDA1 transcript levels are lower in dark-anoxic
starchless mutants deficient for isoamylase (STA7) or ADP-glucose
pyrophosphorylase (STA6) (Posewitz et al. 2004b). Other signals emerging from
the photosynthetic apparatus influence HydA1 on the level of the absolute enzy-
matic activity (i.e., the maximal enzymatic activity detectable in the cells, for
example, by proton/deuterium (H/D) isotope exchange measurements (Jouanneau
et al. 1980) which is independent from physiological electron supply). Usually, this
maximum activity follows the transcript and protein amounts (Happe et al. 1994;
Forestier et al. 2003). H/D exchange activity is hardly detectable in the dark-anoxic
sta6 mutant, consistent with the transcript data shown by Posewitz et al. (2004b),
but reaches significant values under anoxia in the light (Chochois et al. 2009). In
contrast, the H/D exchange activity of the anoxic wild type is rather similar in the
dark or in the light. DCMU has no significant effect on hydrogenase enzyme
activity, while an inhibitor of the cytochrome b6f complex (2,5-dibromo-3-
methyl-6-isopropyl-p-benzoquinone (DBMIB)) as well as the uncoupler carbonyl
cyanide-p-trifluoromethoxyphenylhydrazone (FCCP) result in strongly reduced
H/D exchange activity. It was therefore discussed that the proton gradient which
results from cyclic electron flow is involved in the regulation of the synthesis or
stabilization of active hydrogenase (Chochois et al. 2009).
Hypothetically, the alga might also employ pathways involved in retrograde
plastid-to-nucleus signaling under dark anoxia. Signals emerging from tetrapyrrole
metabolism are implied to result in differential expression of nuclear genes
(Duanmu et al. 2013; Brzezowski et al. 2015). Tetrapyrrole biosynthesis and/or
degradation involve several O2-dependent steps which are probably impaired in
hypoxia. For example, bilin was reported to play a role in retrograde signaling in
178 A. Hemschemeier
Chlamydomonas, and its synthesis from heme is catalyzed by the O2-dependent

enzyme heme oxygenase (Duanmu et al. 2013).
3.4 Nitric Oxide as a Second Messenger
While with the exception of CRR1, the components of O2 sensing and signaling in
Chlamydomonas are as yet unknown, a role of nitric oxide (NO) as a second
messenger is emerging. The NO molecule, a gas and free radical, is a ubiquitous
product of many enzymatic and chemical reactions within a cell (Blokhina and
Fagerstedt 2010; Stern and Zhu 2014). In higher concentrations, NO is toxic, and it
is indeed generated by activated macrophages as part of the pathogen defense (Fang
2004; Stern and Zhu 2014). However, it is also employed as a signaling molecule,
and NO-dependent processes in animals include neuronal communication, vasodi-
lation, and the immune response (Bryan et al. 2009). According to ongoing
research, it appears that NO is employed in signaling pathways in all organism
groups (Besson-Bard et al. 2008; Poyton et al. 2009; Moreau et al. 2010; Baudouin
2011; Baudouin and Hancock 2014; Stern and Zhu 2014). It is therefore not
surprising that it also plays important roles in Chlamydomonas. The responses of
the alga to Cu stress and Fe starvation appear to involve NO-regulated processes
(Zhang et al. 2008; Liping et al. 2013). Upon nitrogen starvation, the cytochrome
b6f complex of Chlamydomonas is degraded in a regulated process which also
involves NO (Wei et al. 2014). Especially well analyzed is the role of NO in
regulating nitrate assimilation in the microalga (de Montaigu et al. 2010; Sanz-
Luque et al. 2013, 2015), and it also plays a role in the hypoxic or anoxic response
of Chlamydomonas (see below). As is the case in plants (Baudouin and Hancock
2014), the molecular mechanisms of NO signaling in Chlamydomonas are in most
cases not understood, with the exception of emerging details on NO production and
detoxification in the context of nitrate assimilation (see below).
3.4.1 NO Signaling in Animals and Plants
In the context of the well-studied “classical” NO-signaling pathway in animals

(Martı́nez-Ruiz et al. 2011), NO synthases (NOSs) produce NO in an NADPH- and
O2-dependent reaction from L-arginine (Arg), which is converted to L-citrulline
(Daff 2010; Santolini 2011). Two of the three NOSs of mammals are regulated by
calcium (Ca2+) and calmodulin (Daff 2010). Additional relevant NO sources in
animals are nitrate and nitrite (Lundberg et al. 2008; Lundberg and Weitzberg
2010), which can be converted to NO nonenzymatically or enzymatically, the latter,
for example, by hemoglobins (Cosby et al. 2003; Rassaf et al. 2007). Important
mediators of NO signaling in animals are the soluble guanylate cyclases (sGCs),
also termed heme/NO-binding guanylate cyclases (Bryan et al. 2009; Martı́nez-
Ruiz et al. 2011). In mammals, sGCs are usually αβ-heterodimers sharing one
N-terminal heme group. The heterodimerization of α- and β-monomers is obliga-

tory in most cases, because individual heme-binding or catalytically essential
residues are contributed from only one monomer (Derbyshire and Marletta 2012).
An exception is the rat β2-subunit, which contains all essential residues within its
monomer sequence and can form functional homodimers (Koglin et al. 2001;
Derbyshire and Marletta 2012). The basic principle of sGC-mediated signaling is
the stimulation of guanylate cyclase activity by the binding of NO to the heme
group and possibly additional sites of the enzyme (Fernhoff et al. 2009; Derbyshire
and Marletta 2012; Underbakke et al. 2014). The cyclic guanosine monophosphate
(cGMP) produced by sGCs acts as the downstream second messenger and influ-
ences mostly cGMP-dependent protein kinases and cGMP-dependent phosphodi-
esterases (PDEs) as well as cGMP-gated ion channels (Lucas et al. 2000; Hofmann
2005; Bryan et al. 2009). PDEs are also responsible for removing cGMP. NO can
also directly, or after reaction with ROS, in the form of a reactive nitrogen species
(RNS) perform regulatory roles. For example, NO is a competitive inhibitor of the
respiratory cytochrome c oxidase and thereby influences the mitochondrial metab-
olism which can result in higher ROS production or an increased AMP:ATP ratio
(Erusalimsky and Moncada 2007). An important regulatory role of NO is conveyed
through posttranslational modifications of proteins, mostly in the form of Cys S-
nitrosylation or tyrosine nitration (Hess et al. 2005; Abello et al. 2009; Martı́nez-
Ruiz et al. 2011; Nakamura and Lipton 2013).
The number of reports about NO-dependent acclimatory processes in plants has
increased over the years, indicating that the plant employs NO signaling under
various conditions and throughout its life cycle (Perazzolli et al. 2006; Hebelstrup
et al. 2013; Baudouin and Hancock 2014; Domingos et al. 2015). Plant NO signaling
shares similarities with that in animals in that, for example, cross talk with other
second messengers (Ca2+, cGMP) or protein S-nitrosylation occurs (Besson-Bard
et al. 2008; Courtois et al. 2008; Astier et al. 2012). However, NOSs have not been
identified in plants yet (Jeandroz et al. 2016). Arg-dependent NO production sensi-
tive to pharmaceuticals interfering with animal NOSs such as L-NAME (Nω-nitro-
L-arginine methyl ester) has been reported to occur in plants (Gas et al. 2009; Gupta
et al. 2011); however, these observations might be due to other Arg-dependent
pathways (Planchet and Kaiser 2006; Besson-Bard et al. 2008; Winter et al. 2015).
For example, polyamines, whose synthesis requires Arg, are involved in NO pro-
duction (Tun et al. 2006; Wimalasekera et al. 2011). An important source for NO in
plants is nitrite, which can be converted to NO chemically and by various enzymes
such as nitrate reductase, plasma membrane-bound nitrite-NO reductase, xanthine
oxidoreductase, cytochrome c oxidase, or hemoglobins (St€ohr and Stremlau 2006;
Wilson et al. 2008; Gupta et al. 2011; Gupta and Igamberdiev 2011; Tiso et al. 2012).
To date, no homologues to animal sGCs have been detected in plants, although
pattern-matching searches have identified some Arabidopsis proteins putatively
having sGC-like functions (Mulaudzi et al. 2011; Domingos et al. 2015). It is
possible that posttranslational modifications through NO play major roles in plants
(Serpa et al. 2007; Tada et al. 2008; Baudouin 2011; Astier et al. 2012; Astier and
Lindermayr 2012; Tavares et al. 2014).
180 A. Hemschemeier
3.4.2 NO Signaling in Chlamydomonas
NO signaling in Chlamydomonas appears to employ both plant and animal strategies

(Fig. 4). Although some algal species contain NOS homologues, Chlamydomonas is
not among those (Jeandroz et al. 2016). However, in contrast to plants, the microalga
contains six genes encoding sGC homologues (de Montaigu et al. 2010). The
deduced polypeptides each contain all amino acid residues described in Derbyshire
and Marletta (2012) to be important for heme-binding and catalytic activity
(de Montaigu et al. 2010; plus own alignments and manual inspection), indicating
that they can function as homodimers. The isoform Cre16.g688901 (de Montaigu
et al. 2010) and the cyclase domain of the Chlamydomonas CYG12 protein (Winger
et al. 2008) are indeed catalytically active in the homodimeric form. The role of NO
in the regulation of nitrate assimilation in Chlamydomonas is the best analyzed, and
the involvement of an sGC, cGMP, and Ca2+ in this process was shown (de Montaigu
et al. 2010; Sanz-Luque et al. 2013, 2015; Chamizo-Ampudia et al. 2016). The
NO-dependent signaling pathway was discovered through a screen for ammonium-
insensitive mutants which, in contrast to the wild type, express genes of the nitrate
assimilation pathway in the presence of ammonium (de Montaigu et al. 2010). In one
Fig. 4 Overview on putative NO production and signaling pathways in Chlamydomonas in the

context of the known pathways in animals. Details are explained in the text. ARC amidoxime
reducing component, cG-IC cGMP-gated ion channel, cGK cGMP-dependent kinase, (cG-)PDE
(cGMP-dependent) phosphodiesterase, CuNiR Cu-binding nitrite NO reductase, L-Cit L-citrulline,
L-NAME Nω-nitro-L-arginine methyl ester, NOS NO synthase, THB truncated hemoglobin
mutant, a gene coding for a putative sGC is affected (Cre16.g688901; note that the
gene was formerly known as CYG56, but in the current genome version, another
protein containing an adenylate/guanylate cyclase domain, Cre13.g603350, is
termed CYG56). The phenotype of the mutant is consistent with analyses of the
Chlamydomonas wild type, in which NO and cGMP accumulate in conditions of
ammonium repression (de Montaigu et al. 2010), and in which NO donors, cGMP
analogues, and PDE inhibitors result in the repression of the nitrate reductase
(NIT1)-encoding gene in the absence of ammonium, whereas sGC inhibitors or an
NO scavenger result in its derepression in the presence of ammonium (de Montaigu
et al. 2010). NO also regulates ammonium and nitrate assimilation sGC- and cGMP-
independently (Sanz-Luque et al. 2013). The high-affinity transport of ammonium,
nitrate, and nitrite as well as NIT1 activity are rapidly and reversibly inhibited by the
external addition of an NO donor, a process independent from inhibitors of sGCs or
PDEs (Sanz-Luque et al. 2013). Here, NO appears to act through posttranslational
modification, possibly S-nitrosylation, which is a process also occurring in
Chlamydomonas as shown by its S-nitrosoproteome (Morisse et al. 2014). Notably,
the inhibitory effect of NO on NIT1 was only observed in whole Chlamydomonas
cells, but not in cell extracts, not in E. coli cells heterologously synthesizing NIT1,
and not in the purified enzyme (Sanz-Luque et al. 2013). This indicates that the
putative posttranslational modification by NO is mediated by organism-specific
cellular structures. Because NO signaling is ubiquitous and involved in different
acclimatory processes in most organisms, there must be means of providing spec-
ificity to the NO signal, for example, by spatiotemporal patterns, protein-protein
interactions, and cross talks with other molecules or conditions (Kone et al. 2003;
Hess et al. 2005; Anand and Stamler 2012; Nakamura and Lipton 2013).
In Chlamydomonas as in plants, no NOS was identified yet, so that other
chemical or enzymatic reactions must be responsible for NO production. Similar
to plants, nitrate reductase seems to be a major source of NO. Nitrite and NIT1-
dependent NO production was shown (Sakihama et al. 2002), and very recently it
was revealed that the molybdoenzyme amidoxime reducing component (ARC) is
involved in this process (Chamizo-Ampudia et al. 2016) (Fig. 4). Like its homo-
logue in humans, Chlamydomonas ARC can be reduced by cytochrome b5 and an
associated reductase (Chamizo-Ampudia et al. 2011), but also by the diaphorase
domain of NIT1, allowing NO production from nitrite (Chamizo-Ampudia et al.
2016). In plants, both nitrate reductase-dependent and -independent processes have
been described (Baudouin 2011; Fr€ohlich and Durner 2011), and this probably
applies to Chlamydomonas, too, because NO-dependent processes have been
reported for Chlamydomonas nit1 mutants (Hemschemeier et al. 2013b; Liping
et al. 2013; Wei et al. 2014). The ammonium-induced repression of NIT1 can be
mimicked by Ca2+ ionophores (see above: certain animal NOSs are activated by
calmodulin), whereas L-NAME relieves ammonium repression. Additionally, Ca2+
ionophores induce and L-NAME impairs NO accumulation within the algal cells
(de Montaigu et al. 2010). This suggests (a) Ca2+-sensitive, Arg-dependent pathway
(s) as reported for plants.
182 A. Hemschemeier
3.4.3 NO Signaling in the Anaerobic Response of Chlamydomonas
The acclimation of Chlamydomonas to anoxic conditions also involves

NO-dependent processes. In the presence of the chemical NO scavenger PTIO
(2-phenyl-4,4,5,5-tetramethylimidazoline-1-oxyl 3-oxide), growth of the wild
type in an anoxic but not in an aerobic atmosphere in the light is strongly impaired,
and the HYDA1 and HYDA2 transcripts accumulate in aerobic cells treated with an
NO donor (Hemschemeier et al. 2013b). Additionally, the amounts of two
sGC-encoding transcripts, CYG11 (Cre07.g320700) and CYG12 (Cre07.
g320750), increase in dark-anoxic C. reinhardtii cells (Hemschemeier et al. 2013a).
Details on the putative NO-dependent hypoxic signaling pathway remain to be
elucidated. The experiments in anoxia were conducted with a Chlamydomonas
strain (CC-124) that has a nit1 nit2 genetic background and is thus deficient for
NIT1 and the central regulator of the nitrate regulon, NIT2 (Camargo et al. 2007).
The mechanism of NO production under this condition (or in this strain) must
therefore be different from the NIT1-ARC system described above. Similarly, the
involvement of NO in the degradation of the cytochrome b6f complex was observed
in nit1 mutants, however, by comparing Chlamydomonas strains with different
genetic backgrounds regarding nitrate and nitrite reductase activity, nitrite as the
NO source was proposed (Wei et al. 2014). Although speculative for the time being,
one might think of several routes. Given an intracellular source of nitrite, its
reduction to NO might occur by hemoglobins (see below) or by ERM3 (Cre08.
g360550), a homologue of Cu-binding nitrite reductases from bacteria and fungi
whose transcript accumulates in dark-anoxic Chlamydomonas cells (Hemschemeier
et al. 2013a). The observed effect of L-NAME on the regulation of nitrate assimila-
tion (de Montaigu et al. 2010) suggests other Arg-dependent pathways. For example,
NO generation from polyamines, involving amine oxidases, was reported for
Arabidopsis (Tun et al. 2006; Wimalasekera et al. 2011, 2015). Transcripts for two
flavin containing and one Cu amine oxidase (AOF1, AOF2, AMX2) accumulate in
dark-anoxic Chlamydomonas cultures (Hemschemeier et al. 2013a). Also, a scenario
can be envisioned in which the above described ARC component reduces intracellu-
lar nitrite utilizing cytochrome b5 instead of NIT1 as the reducing partner. In the
Chlamydomonas CC-124 nit1 nit2 strain, the transcripts encoding cytochrome b5-1
(Cre16.g659350) and cytochrome b5 reductase (CBR1, Cre03.g145547) determined
by Chamizo-Ampudia et al. (2011), to reduce ARC, are present at reasonably high
levels (Hemschemeier et al. 2013a).
Not least, hemoglobins might be involved in the (anoxic) NO metabolism of
Chlamydomonas. The microalga contains 12 genes coding for so-called truncated
hemoglobins (THBs) (Vinogradov et al. 2011; Hemschemeier et al. 2013b). THBs
feature a truncated version of the three-helices-on-three-helices (3/3)-fold of the
“classical” hemoglobins and myoglobins that results in an overall two-helices-on-
two-helices (2/2)-fold (Lecomte et al. 2005; Nardini et al. 2007; Johnson and
Lecomte 2013; Pesce et al. 2013). Hemoglobins are widespread and found in
every kingdom (Vinogradov et al. 2011, 2013a, b; Vázquez-Limón et al. 2012).
Although the first and probably best studied hemoglobins are the O2 transporting
hemoglobins and myoglobins, hemoglobins are recognized today as versatile pro-
teins that fulfil various functions as enzymes or sensors (Hoy and Hargrove 2008;
Vinogradov and Moens 2008; Reeder 2010; Martı́nková et al. 2013). Several
enzymatic activities of hemoglobins involve nitrogen compounds, such as NO
dioxygenation, reduction of hydroxylamine and peroxynitrite, and nitrite to NO
reduction (Gladwin et al. 2003; Gardner 2005; Ascenzi et al. 2008, 2009; De
Marinis et al. 2009; Sturms et al. 2011a, b). Notably, many hemoglobins are capable
of catalyzing various reactions in vitro, so that their in vivo function cannot directly
be inferred from biochemical analyses. Different reaction kinetics and affinities,
however, can give clues. For example, the class 1 nonsymbiotic 3/3 hemoglobins of
plants usually have very high affinities and very low dissociation constants for O2,
making their function as O2 transport proteins unlikely (Hoy and Hargrove 2008;
Smagghe et al. 2009). The function of a hemoglobin can additionally change
depending on the environment or on protein partners. For example, animal hemo-
globin and myoglobin can reduce nitrite to NO under hypoxic conditions (Cosby
et al. 2003; Rassaf et al. 2007; Totzeck et al. 2012). The NO dioxygenase activity of
hemoglobins requires a reducing system that converts the heme group, which is left
oxidized after catalysis, back to the reactive reduced form (Smagghe et al. 2008).
Some, but not all hemoglobins, can be directly reduced by NADPH or FADH2
(Perazzolli et al. 2004; Sainz et al. 2013).
In Chlamydomonas, no 3/3 hemoglobins have been identified yet, which is in
contrast to plants which often contain both 3/3 hemoglobins and THBs (Vázquez-
Limón et al. 2012). The high number of THB genes in Chlamydomonas is rather
unusual, although some protists and Caenorhabditis elegans have also numerous
hemoglobin-encoding genes (Hoogewijs et al. 2004; Tilleman et al. 2011;
Vinogradov et al. 2013a). The domain architecture of the annotated
Chlamydomonas THBs indicates additional functions of the proteins, because
most of them have considerably elongated N- or C-termini with so far unknown
roles (Vinogradov et al. 2011; Hemschemeier et al. 2013b; Huwald et al. 2015). To
date, only two of the genes have been studied on the physiological level, THB1 and
Cre16.g661200 [termed THB8 in Hemschemeier et al. (2013b)]. THB1, which is
the shortest of all Chlamydomonas hemoglobins, has been analyzed most exten-
sively and is well characterized biochemically and structurally (Johnson and
Lecomte 2013, 2014; Johnson et al. 2014; Ciaccio et al. 2015; Rice et al. 2015).
Transcript and protein levels are high only in Chlamydomonas strains that possess
the global nitrate assimilation regulator NIT2 and that are cultivated in the presence
of nitrate (Johnson et al. 2014; Sanz-Luque et al. 2015). THB1 transcript levels can
be further enhanced by treating the cells with NO (Sanz-Luque et al. 2015), and the
protein has NO dioxygenase activity (Johnson et al. 2014; Sanz-Luque et al. 2015).
Notably, the diaphorase domain of NIT1 is able to reduce THB1 so that in vitro,
several cycles of NO dioxygenation are possible (Sanz-Luque et al. 2015). Probably
by abstracting electrons, THB1 protein reduces NIT1 activity in cell extracts, and in
strains with posttranscriptionally reduced THB1 transcript amounts, NIT1 activity
is inversely proportional to THB1 transcript levels (Sanz-Luque et al. 2015). A dual
184 A. Hemschemeier
function of THB1 in both NO detoxification and modulation of NIT1 activity was

therefore proposed, forming a kind of feedback loop, in which the accumulation of
nitrite (e.g., due to low photosynthetic activity) would cause an NO burst, which in
turn would result in electron abstraction from NIT1 through THB1 and thus in
lower nitrite levels (Sanz-Luque et al. 2015).
Cre16.g661200 (THB8) is strongly upregulated in dark-anoxic Chlamydomonas
cells and plays a vital role for the anoxic acclimation of the alga. Strains in which
the THB8 gene is posttranscriptionally downregulated do hardly grow in an anoxic
atmosphere in the light (Hemschemeier et al. 2013b). The function of the THB8
protein is yet unknown. In view of the effects of NO on anoxic growth and
expression of “anaerobic genes” in Chlamydomonas in addition to the observation
that applying the NO scavenger PTIO to the THB8 knockdown strains prevented
their anoxic growth completely, it was postulated that THB8 might be involved in
an NO-dependent signaling pathway. Since also externally added NO did not rescue
the anoxic growth of the knockdown strains, and because treating the recombinant
THB8 protein with NO resulted in spectra consistent with protein nitrosylation, it
was suggested that THB8 might function as an NO carrier (or transnitrosylase)
(Hemschemeier et al. 2013b). The THB8 knockdown strains also showed aberrant
transcript amounts of some anoxia-responsive genes, among those the CYG12 gene
that encodes one of the sGCs of Chlamydomonas (Hemschemeier et al. 2013b).
Though speculative for the time being, this might indicate a feedback loop between
two genes that are most probably both involved in an NO-dependent process.
Whether further THBs play a role in the acclimation of Chlamydomonas to
hypoxia or anoxia remains to be elucidated. Several additional THB genes are
transcriptionally upregulated in dark-anoxic but also in dark-oxic algae
(Hemschemeier et al. 2013a; Huwald et al. 2015). Although only about half of the
THBs of Chlamydomonas have been analyzed and most of them only in vitro, the
observations so far indicate that their functions are not redundant. This is apparent in
Chlamydomonas knockdown transformants that show a clear phenotype
(Hemschemeier et al. 2013b; Sanz-Luque et al. 2015), but is also suggested by
differences in their biochemistry and structure (Johnson et al. 2014; Ciaccio et al.
2015; Huwald et al. 2015; Rice et al. 2015). Hemoglobins are good candidates for
playing roles in the hypoxic or anoxic metabolism. NO metabolism is a plausible
scenario in view of the numerous reports on NO chemistry catalyzed by hemoglo-
bins also in plants, where they are supposed to act as NO scavengers and to modulate
NO levels in signaling cascades (Perazzolli et al. 2006; Hill 2012; Hebelstrup et al.
2013). Because NO dioxygenation consumes electrons, NO scavenging under hyp-
oxic conditions would also contribute to the redox balance (Igamberdiev and Hill
2004). Chlamydomonas THB1, THB2, and THB4 have nitrite reductase activity
in vitro (Ciaccio et al. 2015), so they might be responsible for nitrite-dependent NO
production. Certainly, a function in O2 concentration or transport as reported for
bacterial hemoglobins (Stark et al. 2011; Davidge and Dikshit 2013) but also for
plant nonsymbiotic hemoglobins (Vigeolas et al. 2011) is possible. Hemoglobins
might even function as O2 scavengers and protect the O2-labile fermentative
enzymes of Chlamydomonas in the natural habitat, which is probably rather hypoxic
than completely anoxic. A further possibility is O2 sensing, although the extensions

of Chlamydomonas THBs do not show the typical domains of globin-coupled
sensors such as kinases or cyclases (Martı́nková et al. 2013).
3.5 Conclusions and Outlook
Research on the anoxic metabolism of Chlamydomonas has revealed many details

on its remarkable complexity and flexibility. However, just as many and more
questions remain. For example, most enzymes of the fermentative metabolism
remain poorly characterized, and it is not known how the observed flexibility of
fermentative pathways is regulated. Additional metabolic acclimation strategies
such as the utilization of fermenting substrates other than starch are just emerging to
be revealed, and little is known about the cross talks between the organelles in
which fermentative enzymes have been detected. Also the players and mechanisms
of O2 sensing and signaling are largely unknown to date. In view of the long history
of research on Chlamydomonas and the tools available for its analysis and manip-
ulation, the alga is well suited for the analysis of anoxic signaling strategies, despite
or perhaps precisely because of its particularities that make Chlamydomonas an
organism somewhere in between animals, plants, and bacteria. Apart from being a
model, the adaptable alga is in itself a fascinating organism, and new insights into
its (dark) anoxic metabolism and its regulation will not least result in a deeper
understanding of ecosystems which are dependent on healthy O2 producers.
References
Abello N, Kerstjens HA, Postma DS, Bischoff R (2009) Protein tyrosine nitration: selectivity,
physicochemical and biological consequences, denitration, and proteomics methods for the
identification of tyrosine-nitrated proteins. J Proteome Res 8:3222–3238
Allen MD, Kropat J, Merchant SS (2008) Regulation and localization of isoforms of the aerobic
oxidative cyclase in Chlamydomonas reinhardtii. Photochem Photobiol 84:1336–1342
Amend JP, Shock EL (2001) Energetics of overall metabolic reactions of thermophilic and
hyperthermophilic Archaea and bacteria. FEMS Microbiol Rev 25:175–243
Anand P, Stamler JS (2012) Enzymatic mechanisms regulating protein S-nitrosylation: implica-
tions in health and disease. J Mol Med (Berl) 90:233–244
Anbar AD (2008) Oceans. Elements and evolution. Science 322:1481–1483
Ansell R, Granath K, Hohmann S, Thevelein JM, Adler L (1997) The two isoenzymes for yeast
NAD+-dependent glycerol 3-phosphate dehydrogenase encoded by GPD1 and GPD2 have
distinct roles in osmoadaptation and redox regulation. EMBO J 16:2179–2187
Ascenzi P, De Marinis E, Coletta M, Visca P (2008) H2O2 and NO scavenging by Mycobacterium
leprae truncated hemoglobin O. Biochem Biophys Res Commun 373:197–201
Ascenzi P, De Marinis E, Visca P, Ciaccio C, Coletta M (2009) Peroxynitrite detoxification by
ferryl Mycobacterium leprae truncated hemoglobin O. Biochem Biophys Res Commun
380:392–396
186 A. Hemschemeier
Astier J, Lindermayr C (2012) Nitric oxide-dependent posttranslational modification in plants: an

update. Int J Mol Sci 13:15193–15208
Astier J, Kulik A, Koen E, Besson-Bard A, Bourque S, Jeandroz S, Lamotte O, Wendehenne D
(2012) Protein S-nitrosylation: what’s going on in plants? Free Radic Biol Med 53:1101–1110
Atteia A, van Lis R, Gelius-Dietrich G, Adrait A, Garin J, Joyard J, Rolland N, Martin W (2006)
Pyruvate formate-lyase and a novel route of eukaryotic ATP synthesis in Chlamydomonas
mitochondria. J Biol Chem 281:9909–9918
Atteia A, Adrait A, Brugière S, Tardif M, van Lis R, Deusch O, Dagan T, Kuhn L, Gontero B,
Martin W, Garin J, Joyard J, Rolland N (2009) A proteomic survey of Chlamydomonas
reinhardtii mitochondria sheds new light on the metabolic plasticity of the organelle and on
the nature of the α-proteobacterial mitochondrial ancestor. Mol Biol Evol 26:1533–1548
Atteia A, van Lis R, Tielens AG, Martin WF (2013) Anaerobic energy metabolism in unicellular
photosynthetic eukaryotes. Biochim Biophys Acta 1827:210–223
Bailey-Serres J, Voesenek LA (2008) Flooding stress: acclimations and genetic diversity. Annu
Rev Plant Biol 59:313–339
Bailey-Serres J, Fukao T, Gibbs DJ, Holdsworth MJ, Lee SC, Licausi F, Perata P, Voesenek LA,
van Dongen JT (2012) Making sense of low oxygen sensing. Trends Plant Sci 17:129–138
Batyrova KA, Tsygankov AA, Kosourov SN (2012) Sustained hydrogen photoproduction by
phosphorus-deprived Chlamydomonas reinhardtii cultures. Int J Hydrog Energy 37:8834–8839
Baudouin E (2011) The language of nitric oxide signalling. Plant Biol (Stuttg) 13:233–242
Baudouin E, Hancock J (2014) Nitric oxide signalling in plants. Front Plant Sci 4:553
Bekker A, Holland HD, Wang PL, Rumble D III, Stein HJ, Hannah JL, Coetzee LL, Beukes NJ
(2004) Dating the rise of atmospheric oxygen. Nature 427:117–120
Besson-Bard A, Pugin A, Wendehenne D (2008) New insights into nitric oxide signaling in plants.
Annu Rev Plant Biol 59:21–39
Bien CM, Espenshade PJ (2010) Sterol regulatory element binding proteins in fungi: hypoxic
transcription factors linked to pathogenesis. Eukaryot Cell 9:352–359
Birkenbihl RP, Jach G, Saedler H, Huijser P (2005) Functional dissection of the plant-specific
SBP-domain: overlap of the DNA-binding and nuclear localization domains. J Mol Biol
352:585–596
Blaby IK, Blaby-Haas CE, Tourasse N, Hom EF, Lopez D, Aksoy M, Grossman A, Umen J,
Dutcher S, Porter M, King S, Witman GB, Stanke M, Harris EH, Goodstein D, Grimwood J,
Schmutz J, Vallon O, Merchant SS, Prochnik S (2014) The Chlamydomonas genome project: a
decade on. Trends Plant Sci 19:672–680
Blaby-Haas CE, Castruita M, Fitz-Gibbon ST, Kropat J, Merchant SS (2016) Ni induces the
CRR1-dependent regulon revealing overlap and distinction between hypoxia and Cu defi-
ciency responses in Chlamydomonas reinhardtii. Metallomics 8(7):679–691. doi:10.1039/
c1036mt00063k
Blokhina O, Fagerstedt KV (2010) Oxidative metabolism, ROS and NO under oxygen deprivation.
Plant Physiol Biochem 48:359–373
Branco-Price C, Kaiser KA, Jang CJ, Larive CK, Bailey-Serres J (2008) Selective mRNA
translation coordinates energetic and metabolic adjustments to cellular oxygen deprivation
and reoxygenation in Arabidopsis thaliana. Plant J 56:743–755
Bruchhaus I, Tannich E (1994) Purification and molecular characterization of the NAD+-dependent
acetaldehyde/alcohol dehydrogenase from Entamoeba histolytica. Biochem J 303:743–748
Bryan NS, Bian K, Murad F (2009) Discovery of the nitric oxide signaling pathway and targets for
drug development. Front Biosci 14:1–18
Brzezowski P, Richter AS, Grimm B (2015) Regulation and function of tetrapyrrole biosynthesis
in plants and algae. Biochim Biophys Acta 1847:968–985
Bueno E, Mesa S, Bedmar EJ, Richardson DJ, Delgado MJ (2012) Bacterial adaptation of
respiration from oxic to microoxic and anoxic conditions: redox control. Antioxid Redox
Signal 16:819–852
Buick R (2008) When did oxygenic photosynthesis evolve? Philos Trans R Soc Lond Ser B Biol
Sci 363:2731–2743
Buis JM, Broderick JB (2005) Pyruvate formate-lyase activating enzyme: elucidation of a novel
mechanism for glycyl radical formation. Arch Biochem Biophys 433:288–296
Burgess SJ, Tredwell G, Molnar A, Bundy JG, Nixon PJ (2012) Artificial microRNA-mediated
knockdown of pyruvate formate lyase (PFL1) provides evidence for an active 3-hydroxybutyrate
production pathway in the green alga Chlamydomonas reinhardtii. J Biotechnol 162:57–66
Burgess SJ, Taha H, Yeoman JA, Iamshanova O, Chan KX, Boehm M, Behrends V, Bundy JG,
Bialek W, Murray JW, Nixon PJ (2016) Identification of the elusive pyruvate reductase of
Chlamydomonas reinhardtii chloroplasts. Plant Cell Physiol 57:82–94
Butler G (2013) Hypoxia and gene expression in eukaryotic microbes. Annu Rev Microbiol
67:291–312
Cabiscol E, Aguilar J, Ros J (1994) Metal-catalyzed oxidation of Fe2+ dehydrogenases. Consensus
target sequence between propanediol oxidoreductase of Escherichia coli and alcohol dehydro-
genase II of Zymomonas mobilis. J Biol Chem 269:6592–6597
Camargo A, Llamas A, Schnell RA, Higuera JJ, González-Ballester D, Lefebvre PA, Fernández E,
Galván A (2007) Nitrate signaling by the regulatory gene NIT2 in Chlamydomonas. Plant Cell
19:3491–3503
reveals connections between copper nutrition and multiple metabolic steps. Plant Cell
23:1273–1292
Catalanotti C, Dubini A, Subramanian V, Yang W, Magneschi L, Mus F, Seibert M, Posewitz MC,
Grossman AR (2012) Altered fermentative metabolism in Chlamydomonas reinhardtii mutants
lacking pyruvate formate lyase and both pyruvate formate lyase and alcohol dehydrogenase.
Catalanotti C, Yang W, Posewitz MC, Grossman AR (2013) Fermentation metabolism and its
evolution in algae. Front Plant Sci 4:150
Chabrière E, Charon MH, Volbeda A, Pieulle L, Hatchikian EC, Fontecilla-Camps JC (1999)
Crystal structures of the key anaerobic enzyme pyruvate:ferredoxin oxidoreductase, free and in
complex with pyruvate. Nat Struct Biol 6:182–190
Chamizo-Ampudia A, Galván A, Fernández E, Llamas A (2011) The Chlamydomonas reinhardtii
molybdenum cofactor enzyme crARC has a Zn-dependent activity and protein partners similar
to those of its human homologue. Eukaryot Cell 10:1270–1282
Chamizo-Ampudia A, Sanz-Luque E, Llamas A, Oca~ na-Calahorro F, Mariscal V, Carreras A,
Barroso JB, Galván A, Fernández E (2016) A dual system formed by the ARC and NR
molybdoenzymes mediates nitrite-dependent NO production in Chlamydomonas. Plant Cell
Environ 39(10):2097–2107. doi:10.1111/pce.12739
Chen JC, Hsieh SI, Kropat J, Merchant SS (2008) A ferroxidase encoded by FOX1 contributes to
iron assimilation under conditions of poor iron nutrition in Chlamydomonas. Eukaryot Cell
7:541–545
Chochois V, Dauvillée D, Beyly A, Tolleter D, Cuiné S, Timpano H, Ball S, Cournac L, Peltier G
(2009) Hydrogen production in Chlamydomonas: photosystem II-dependent and -independent
pathways differ in their requirement for starch metabolism. Plant Physiol 151:631–640
Chochois V, Constans L, Dauvillée D, Beyly A, Solivérès M, Ball S, Peltier G, Cournac L (2010)
Relationships between PSII-independent hydrogen bioproduction and starch metabolism as
evidenced from isolation of starch catabolism mutants in the green alga Chlamydomonas
reinhardtii. Int J Hydrog Energy 35:10731–10740
Ciaccio C, Oca~na-Calahorro F, Droghetti E, Tundo GR, Sanz-Luque E, Polticelli F, Visca P,
Smulevich G, Ascenzi P, Coletta M (2015) Functional and spectroscopic characterization of
Chlamydomonas reinhardtii truncated hemoglobins. PLoS One 10:e0125005
188 A. Hemschemeier
Cosby K, Partovi KS, Crawford JH, Patel RP, Reiter CD, Martyr S, Yang BK, Waclawiw MA,
Zalos G, Xu X, Huang KT, Shields H, Kim-Shapiro DB, Schechter AN, Cannon RO III,
Gladwin MT (2003) Nitrite reduction to nitric oxide by deoxyhemoglobin vasodilates the
human circulation. Nat Med 9:1498–1505
Courtois C, Besson A, Dahan J, Bourque S, Dobrowolska G, Pugin A, Wendehenne D (2008)
Nitric oxide signalling in plants: interplays with Ca2+ and protein kinases. J Exp Bot
59:155–163
Daff S (2010) NO synthase: structures and mechanisms. Nitric Oxide 23:1–11
Davidge KS, Dikshit KL (2013) Haemoglobins of Mycobacteria: structural features and biological
functions. Adv Microb Physiol 63:147–194
De Marinis E, Casella L, Ciaccio C, Coletta M, Visca P, Ascenzi P (2009) Catalytic peroxidation
of nitrogen monoxide and peroxynitrite by globins. IUBMB Life 61:62–73
de Montaigu A, Sanz-Luque E, Gálvan A, Fernández E (2010) A soluble guanylate cyclase
mediates negative signaling by ammonium on expression of nitrate reductase in
Chlamydomonas. Plant Cell 22:1532–1548
Derbyshire ER, Marletta MA (2012) Structure and regulation of soluble guanylate cyclase. Annu
Rev Biochem 81:533–559
Dietz KJ, Vogel MO, Viehhauser A (2010) AP2/EREBP transcription factors are part of gene
regulatory networks and integrate metabolic, hormonal and environmental signals in stress
acclimation and retrograde signalling. Protoplasma 245:3–14
Domingos P, Prado AM, Wong A, Gehring C, Feijo JA (2015) Nitric oxide: a multitasked
signaling gas in plants. Mol Plant 8:506–520
Drew MC (1997) Oxygen deficiency and root metabolism: injury and acclimation under hypoxia
and anoxia. Annu Rev Plant Physiol Plant Mol Biol 48:223–250
Duanmu D, Casero D, Dent RM, Gallaher S, Yang W, Rockwell NC, Martin SS, Pellegrini M,
Niyogi KK, Merchant SS, Grossman AR, Lagarias JC (2013) Retrograde bilin signaling
enables Chlamydomonas greening and phototrophic survival. Proc Natl Acad Sci U S A
110:3621–3626
Dubini A, Ghirardi ML (2015) Engineering photosynthetic organisms for the production of
biohydrogen. Photosynth Res 123:241–253
Dubini A, Mus F, Seibert M, Grossman AR, Posewitz MC (2009) Flexibility in anaerobic
metabolism as revealed in a mutant of Chlamydomonas reinhardtii lacking hydrogenase
activity. J Biol Chem 284:7201–7213
Echave P, Tamarit J, Cabiscol E, Ros J (2003) Novel antioxidant role of alcohol dehydrogenase E
from Escherichia coli. J Biol Chem 278:30193–30198
Erickson E, Wakao S, Niyogi KK (2015) Light stress and photoprotection in Chlamydomonas
reinhardtii. Plant J 82:449–465
Eriksson M, Moseley JL, Tottey S, Del Campo JA, Quinn J, Kim Y, Merchant S (2004) Genetic
dissection of nutritional copper signaling in Chlamydomonas distinguishes regulatory and
target genes. Genetics 168:795–807
Erusalimsky JD, Moncada S (2007) Nitric oxide and mitochondrial signaling: from physiology to
pathophysiology. Arterioscler Thromb Vasc Biol 27:2524–2531
Fábián Z, Taylor CT, Nguyen LK (2016) Understanding complexity in the HIF signaling pathway
using systems biology and mathematical modeling. J Mol Med (Berl) 94:377–390
Falkowski PG, Katz ME, Milligan AJ, Fennel K, Cramer BS, Aubry MP, Berner RA, Novacek MJ,
Zapol WM (2005) The rise of oxygen over the past 205 million years and the evolution of large
placental mammals. Science 309:2202–2204
Fang FC (2004) Antimicrobial reactive oxygen and nitrogen species: concepts and controversies.
Nat Rev Microbiol 2:820–832
Fernhoff NB, Derbyshire ER, Marletta MA (2009) A nitric oxide/cysteine interaction mediates the
activation of soluble guanylate cyclase. Proc Natl Acad Sci U S A 106:21602–21607
Fey V, Wagner R, Bräutigam K, Pfannschmidt T (2005) Photosynthetic redox control of nuclear
gene expression. J Exp Bot 56:1491–1498
Flowers JM, Hazzouri KM, Pham GM, Rosas U, Bahmani T, Khraiwesh B, Nelson DR, Jijakli K,
Abdrabu R, Harris EH, Lefebvre PA, Hom EF, Salehi-Ashtiani K, Purugganan MD (2015)
Whole-genome resequencing reveals extensive natural variation in the model green alga
Forestier M, King P, Zhang LP, Posewitz M, Schwarzer S, Happe T, Ghirardi ML, Seibert M
(2003) Expression of two [Fe]-hydrogenases in Chlamydomonas reinhardtii under anaerobic
conditions. Eur J Biochem 270:2750–2758
Fr€ohlich A, Durner J (2011) The hunt for plant nitric oxide synthase (NOS): is one really needed?
Plant Sci 181:401–404
Fukao T, Bailey-Serres J (2004) Plant responses to hypoxia – is survival a balancing act? Trends
Plant Sci 9:449–456
Fukuda E, Kino H, Matsuzawa H, Wakagi T (2001) Role of a highly conserved YPITP motif in
2-oxoacid: ferredoxin oxidoreductase: heterologous expression of the gene from Sulfolobus sp.
strain 7, and characterization of the recombinant and variant enzymes. Eur J Biochem
268:5639–5646
Gallaher SD, Fitz-Gibbon ST, Glaesener AG, Pellegrini M, Merchant SS (2015) Chlamydomonas
genome resource for laboratory strains reveals a mosaic of sequence variation, identifies true
strain histories, and enables strain-specific studies. Plant Cell 27:2335–2352
Garcia-Molina A, Xing S, Huijser P (2014) Functional characterisation of Arabidopsis SPL7
conserved protein domains suggests novel regulatory mechanisms in the Cu deficiency
response. BMC Plant Biol 14:231
Gardner PR (2005) Nitric oxide dioxygenase function and mechanism of flavohemoglobin,
hemoglobin, myoglobin and their associated reductases. J Inorg Biochem 99:247–266
Gas E, Flores-Pérez U, Sauret-Güeto S, Rodrı́guez-Concepción M (2009) Hunting for plant nitric
oxide synthase provides new evidence of a central role for plastids in nitric oxide metabolism.
Gfeller RP, Gibbs M (1984) Fermentative metabolism of Chlamydomonas reinhardtii: I. Analysis
of fermentative products from starch in dark and light. Plant Physiol 75:212–218
Ghysels B, Godaux D, Matagne RF, Cardol P, Franck F (2013) Function of the chloroplast
hydrogenase in the microalga Chlamydomonas: the role of hydrogenase and state transitions
during photosynthetic activation in anaerobiosis. PLoS One 8:e64161
Ginger ML, Fritz-Laylin LK, Fulton C, Cande WZ, Dawson SC (2010) Intermediary metabolism
in protists: a sequence-based view of facultative anaerobic metabolism in evolutionarily
diverse eukaryotes. Protist 161:642–671
Gladwin MT, Lancaster JR Jr, Freeman BA, Schechter AN (2003) Nitric oxide’s reactions with
hemoglobin: a view through the SNO-storm. Nat Med 9:496–500
Godaux D, Bailleul B, Berne N, Cardol P (2015) Induction of photosynthetic carbon fixation in
anoxia relies on hydrogenase activity and proton-gradient regulation-like1-mediated cyclic
electron flow in Chlamydomonas reinhardtii. Plant Physiol 168:648–658
Goldblatt C, Lenton TM, Watson AJ (2006) Bistability of atmospheric oxygen and the great
oxidation. Nature 443:683–686
Goldfine H (1965) The evolution of oxygen as a biosynthetic reagent. J Gen Physiol 49
(Suppl):253–274
Graves DA, Spradlin GM, Greenbaum E (1990) Effect of oxygen on photoautotrophic and
heterotrophic growth of Chlamydomonas reinhardtii in an anoxic atmosphere. Photochem
Photobiol 52:585–590
Green J, Rolfe MD, Smith LJ (2014) Transcriptional regulation of bacterial virulence gene
expression by molecular oxygen and nitric oxide. Virulence 5:794–809
Gupta KJ, Igamberdiev AU (2011) The anoxic plant mitochondrion as a nitrite: NO reductase.
Mitochondrion 11:537–543
Gupta KJ, Fernie AR, Kaiser WM, van Dongen JT (2011) On the origins of nitric oxide. Trends
Plant Sci 16:160–168
190 A. Hemschemeier
Halliwell B (2006) Reactive species and antioxidants. Redox biology is a fundamental theme of
aerobic life. Plant Physiol 141:312–322
Hammond DJ, Aman RA, Wang CC (1985) The role of compartmentation and glycerol kinase in
the synthesis of ATP within the glycosome of Trypanosoma brucei. J Biol Chem
260:15646–15654
Happe T, Kaminski A (2002) Differential regulation of the Fe-hydrogenase during anaerobic
adaptation in the green alga Chlamydomonas reinhardtii. Eur J Biochem 269:1022–1032
Happe T, Mosler B, Naber JD (1994) Induction, localization and metal content of hydrogenase in
the green alga Chlamydomonas reinhardtii. Eur J Biochem 222:769–774
Harris EH (2001) Chlamydomonas as a model organism. Annu Rev Plant Physiol Plant Mol Biol
52:363–406
Hebelstrup KH, Shah JK, Igamberdiev AU (2013) The role of nitric oxide and hemoglobin in plant
development and morphogenesis. Physiol Plant 148:457–469
Hedges SB, Blair JE, Venturi ML, Shoe JL (2004) A molecular timescale of eukaryote evolution
and the rise of complex multicellular life. BMC Evol Biol 4:2
Hemschemeier A (2013) Photo-bleaching of Chlamydomonas reinhardtii after dark-anoxic incu-
bation. Plant Signal Behav 8(11):e27263
Hemschemeier A, Happe T (2011) Alternative photosynthetic electron transport pathways during
anaerobiosis in the green alga Chlamydomonas reinhardtii. Biochim Biophys Acta
1807:919–926
Hemschemeier A, Jacobs J, Happe T (2008) Biochemical and physiological characterization of the
pyruvate formate-lyase Pfl1 of Chlamydomonas reinhardtii, a typically bacterial enzyme in a
eukaryotic alga. Eukaryot Cell 7:518–526
Hemschemeier A, Casero D, Liu B, Benning C, Pellegrini M, Happe T, Merchant SS (2013a)
Copper response regulator1-dependent and -independent responses of the Chlamydomonas
reinhardtii transcriptome to dark anoxia. Plant Cell 25:3186–3211
Hemschemeier A, Düner M, Casero D, Merchant SS, Winkler M, Happe T (2013b) Hypoxic
survival requires a 2-on-2 hemoglobin in a process involving nitric oxide. Proc Natl Acad Sci U
S A 110:10854–10859
Hess DT, Matsumoto A, Kim SO, Marshall HE, Stamler JS (2005) Protein S-nitrosylation:
purview and parameters. Nat Rev Mol Cell Biol 6:150–166
Hill RD (2012) Non-symbiotic haemoglobins – what’s happening beyond nitric oxide scavenging?
AoB Plants 2012:pls004
Hill KL, Merchant S (1992) In vivo competition between plastocyanin and a copper-dependent
regulator of the Chlamydomonas reinhardtii cytochrome c6 gene. Plant Physiol 100:319–326
Hill KL, Merchant S (1995) Coordinate expression of coproporphyrinogen oxidase and cyto-
chrome c6 in the green alga Chlamydomonas reinhardtii in response to changes in copper
availability. EMBO J 14:857–865
Hill KL, Li HH, Singer J, Merchant S (1991) Isolation and structural characterization of the
Chlamydomonas reinhardtii gene for cytochrome c6. Analysis of the kinetics and metal
specificity of its copper-responsive expression. J Biol Chem 266:15060–15067
Hofmann F (2005) The biology of cyclic GMP-dependent protein kinases. J Biol Chem 280:1–4
H€ohner R, Barth J, Magneschi L, Jaeger D, Niehues A, Bald T, Grossman A, Fufezan C, Hippler M
(2013) The metabolic status drives acclimation of iron deficiency responses in
Chlamydomonas reinhardtii as revealed by proteomics based hierarchical clustering and
reverse genetics. Mol Cell Proteomics 12:2774–2790
Hon T, Dodd A, Dirmeier R, Gorman N, Sinclair PR, Zhang L, Poyton RO (2003) A mechanism of
oxygen sensing in yeast. Multiple oxygen-responsive steps in the heme biosynthetic pathway
affect Hap1 activity. J Biol Chem 278:50771–50780
Hong-Hermesdorf A, Miethke M, Gallaher SD, Kropat J, Dodani SC, Chan J, Barupala D,
Domaille DW, Shirasaki DI, Loo JA, Weber PK, Pett-Ridge J, Stemmler TL, Chang CJ,
Merchant SS (2014) Subcellular metal imaging identifies dynamic sites of Cu accumulation
in Chlamydomonas. Nat Chem Biol 10:1034–1042
Hoogewijs D, Geuens E, Dewilde S, Moens L, Vierstraete A, Vinogradov S, Vanfleteren J (2004)

Genome-wide analysis of the globin gene family of C. elegans. IUBMB Life 56:697–702
H€ortensteiner S, Kräutler B (2011) Chlorophyll breakdown in higher plants. Biochim Biophys
Acta 1807:977–988
Hoy JA, Hargrove MS (2008) The structure and function of plant hemoglobins. Plant Physiol
Biochem 46:371–379
micronutrient deficiency in Chlamydomonas reinhardtii. Mol Cell Proteomics 12:65–86
Hug LA, Stechmann A, Roger AJ (2010) Phylogenetic distributions and histories of proteins
involved in anaerobic pyruvate metabolism in eukaryotes. Mol Biol Evol 27:311–324
Hughes AL, Todd BL, Espenshade PJ (2005) SREBP pathway responds to sterols and functions as
an oxygen sensor in fission yeast. Cell 120:831–842
Husic DW, Tolbert NE (1985) Anaerobic formation of D-lactate and partial purification and
characterization of a pyruvate reductase from Chlamydomonas reinhardtii. Plant Physiol
78:277–284
Huwald D, Schrapers P, Kositzki R, Haumann M, Hemschemeier A (2015) Characterization of
unusual truncated hemoglobins of Chlamydomonas reinhardtii suggests specialized functions.
Planta 242:167–185
Igamberdiev AU, Hill RD (2004) Nitrate, NO and haemoglobin in plant adaptation to hypoxia: an
alternative to classic fermentation pathways. J Exp Bot 55:2473–2482
Imlay JA (2006) Iron-sulphur clusters and the problem with oxygen. Mol Microbiol 59:1073–1082
Jacobs J, Pudollek S, Hemschemeier A, Happe T (2009) A novel, anaerobically induced ferredoxin
in Chlamydomonas reinhardtii. FEBS Lett 583:325–329
Jang H, Ehrenreich IM (2012) Genome-wide characterization of genetic variation in the unicel-
lular, green alga Chlamydomonas reinhardtii. PLoS One 7:e41307
Jeandroz S, Wipf D, Stuehr DJ, Lamattina L, Melkonian M, Tian Z, Zhu Y, Carpenter EJ, Wong
GK, Wendehenne D (2016) Occurrence, structure, and evolution of nitric oxide synthase-like
proteins in the plant kingdom. Sci Signal 9:re2
Johnson EA, Lecomte JT (2013) The globins of cyanobacteria and algae. Adv Microb Physiol
63:195–272
Johnson EA, Lecomte JT (2014) Characterization of the truncated hemoglobin THB1 from protein
extracts of Chlamydomonas reinhardtii. F1000Res 3:294
Johnson EA, Rice SL, Preimesberger MR, Nye DB, Gilevicius L, Wenke BB, Brown JM, Witman
GB, Lecomte JT (2014) Characterization of THB1, a Chlamydomonas reinhardtii truncated
hemoglobin: linkage to nitrogen metabolism and identification of lysine as the distal heme
ligand. Biochemistry (Mosc) 53:4573–4589
Jouanneau Y, Kelley BC, Berlier Y, Lespinat PA, Vignais PM (1980) Continuous monitoring, by
mass spectrometry, of H2 production and recycling in Rhodopseudomonas capsulata. J Bacteriol
143:628–636
Juntawong P, Bailey-Serres J (2012) Dynamic light regulation of translation status in Arabidopsis
thaliana. Front Plant Sci 3:66
Kessler D, Leibrecht I, Knappe J (1991) Pyruvate-formate-lyase-deactivase and acetyl-CoA
reductase activities of Escherichia coli reside on a polymeric protein particle encoded by
adhE. FEBS Lett 281:59–63
Kleine T, Voigt C, Leister D (2009) Plastid signalling to the nucleus: messengers still lost in the
mists? Trends Genet 25:185–192
Knappe J, Neugebauer FA, Blaschkowski HP, Gänzler M (1984) Post-translational activation
introduces a free radical into pyruvate formate-lyase. Proc Natl Acad Sci U S A 81:1332–1335
Koglin M, Vehse K, Budaeus L, Scholz H, Behrends S (2001) Nitric oxide activates the β2 subunit
of soluble guanylyl cyclase in the absence of a second subunit. J Biol Chem 276:30737–30743
192 A. Hemschemeier
Kone BC, Kuncewicz T, Zhang W, Yu ZY (2003) Protein interactions with nitric oxide synthases:
controlling the right time, the right place, and the right amount of nitric oxide. Am J Physiol
Renal Physiol 285:F178–F190
Kreuzberg K (1984) Starch fermentation via a formate producing pathway in Chlamydomonas
reinhardii, Chlorogonium elongatum and Chlorella fusca. Physiol Plant 61:87–94
Kreuzberg K, Kl€ock G, Grobheiser D (1987) Subcellular distribution of pyruvate-degrading
enzymes in Chlamydomonas reinhardtii studied by an improved protoplast fractionation
procedure. Physiol Plant 69:481–488
Kropat J, Tottey S, Birkenbihl RP, Depege N, Huijser P, Merchant S (2005) A regulator of
nutritional copper signaling in Chlamydomonas is an SBP domain protein that recognizes the
GTAC core of copper response element. Proc Natl Acad Sci U S A 102:18730–18735
Kropat J, Gallaher SD, Urzica EI, Nakamoto SS, Strenkert D, Tottey S, Mason AZ, Merchant SS
(2015) Copper economy in Chlamydomonas: prioritized allocation and reallocation of copper
to respiration vs. photosynthesis. Proc Natl Acad Sci U S A 112:2644–2651
La Fontaine S, Quinn JM, Nakamoto SS, Page MD, Gohre V, Moseley JL, Kropat J, Merchant S
(2002) Copper-dependent iron assimilation pathway in the model photosynthetic eukaryote
Chlamydomonas reinhardtii. Eukaryot Cell 1:736–757
Lambertz C, Hemschemeier A, Happe T (2010) Anaerobic expression of the ferredoxin-encoding
FDX5 gene of Chlamydomonas reinhardtii is regulated by the Crr1 transcription factor.
Eukaryot Cell 9:1747–1754
Lecomte JT, Vuletich DA, Lesk AM (2005) Structural divergence and distant relationships in
proteins: evolution of the globins. Curr Opin Struct Biol 15:290–301
Lee CYS, Stewart EV, Hughes BT, Espenshade PJ (2009) Oxygen-dependent binding of Nro1 to
the prolyl hydroxylase Ofd1 regulates SREBP degradation in yeast. EMBO J 28:135–143
Liang X, Nazarenus TJ, Stone JM (2008) Identification of a consensus DNA-binding site for the
Arabidopsis thaliana SBP domain transcription factor, AtSPL14, and binding kinetics by
surface plasmon resonance. Biochemistry (Mosc) 47:3645–3653
Liping Z, Hongbo S, Xiaohua L, Zhaopu L (2013) Gene regulation of iron-deficiency responses is
associated with carbon monoxide and heme oxydase 1 in Chlamydomonas reinhardtii. PLoS
One 8:e53835
Lucas KA, Pitari GM, Kazerounian S, Ruiz-Stewart I, Park J, Schulz S, Chepenik KP, Waldman
SA (2000) Guanylyl cyclases and signaling by cyclic GMP. Pharmacol Rev 52:375–414
Lundberg JO, Weitzberg E (2010) NO-synthase independent NO generation in mammals.
Biochem Biophys Res Commun 396:39–45
Lundberg JO, Weitzberg E, Gladwin MT (2008) The nitrate-nitrite-nitric oxide pathway in
physiology and therapeutics. Nat Rev Drug Discov 7:156–167
Lyons TW (2007) Palaeoclimate: oxygen’s rise reduced. Nature 448:1005–1006
Magneschi L, Catalanotti C, Subramanian V, Dubini A, Yang W, Mus F, Posewitz MC, Seibert M,
Perata P, Grossman AR (2012) A mutant in the ADH1 gene of Chlamydomonas reinhardtii
elicits metabolic restructuring during anaerobiosis. Plant Physiol 158:1293–1305
Makiuchi T, Nozaki T (2014) Highly divergent mitochondrion-related organelles in anaerobic
parasitic protozoa. Biochimie 100:3–17
Malpica R, Sandoval GR, Rodriguez C, Franco B, Georgellis D (2006) Signaling by the arc
two-component system provides a link between the redox state of the quinone pool and gene
expression. Antioxid Redox Signal 8:781–795
Martı́nez-Ruiz A, Cadenas S, Lamas S (2011) Nitric oxide signaling: classical, less classical, and
nonclassical mechanisms. Free Radic Biol Med 51:17–29
Martı́nková M, Kitanishi K, Shimizu T (2013) Heme-based globin-coupled oxygen sensors:
linking oxygen binding to functional regulation of diguanylate cyclase, histidine kinase, and
methyl-accepting chemotaxis. J Biol Chem 288:27702–27711
Meinecke B, Bertram J, Gottschalk G (1989) Purification and characterization of the pyruvate-
ferredoxin oxidoreductase from Clostridium acetobutylicum. Arch Microbiol 152:244–250
Melis A, Zhang L, Forestier M, Ghirardi ML, Seibert M (2000) Sustained photobiological

hydrogen gas production upon reversible inactivation of oxygen evolution in the green alga
Mense SM, Zhang L (2006) Heme: a versatile signaling molecule controlling the activities of
diverse regulators ranging from transcription factors to MAP kinases. Cell Res 16:681–692
Merchant S, Bogorad L (1986) Regulation by copper of the expression of plastocyanin and
cytochrome c552 in Chlamydomonas reinhardtii. Mol Cell Biol 6:462–469
Merchant S, Hill K, Howe G (1991) Dynamic interplay between two copper-titrating components
in the transcriptional regulation of cyt c6. EMBO J 10:1383–1389
Moreau M, Lindermayr C, Durner J, Klessig DF (2010) NO synthesis and signaling in plants –
where do we stand? Physiol Plant 138:372–383
Morisse S, Zaffagnini M, Gao XH, Lemaire SD, Marchand CH (2014) Insight into Protein
S-nitrosylation in Chlamydomonas reinhardtii. Antioxid Redox Signal 21:1271–1284
Mosavi LK, Cammett TJ, Desrosiers DC, Peng ZY (2004) The ankyrin repeat as molecular
architecture for protein recognition. Protein Sci 13:1435–1448
Moseley J, Quinn J, Eriksson M, Merchant S (2000) The Crd1 gene encodes a putative di-iron
enzyme required for photosystem I accumulation in copper deficiency and hypoxia in
Chlamydomonas reinhardtii. EMBO J 19:2139–2151
Moseley JL, Allinger T, Herzog S, Hoerth P, Wehinger E, Merchant S, Hippler M (2002a)
21:6709–6720
Moseley JL, Page MD, Alder NP, Eriksson M, Quinn J, Soto F, Theg SM, Hippler M, Merchant S
(2002b) Reciprocal expression of two candidate di-iron enzymes affecting photosystem I and
light-harvesting complex accumulation. Plant Cell 14:673–688
Mulaudzi T, Ludidi N, Ruzvidzo O, Morse M, Hendricks N, Iwuoha E, Gehring C (2011)
Identification of a novel Arabidopsis thaliana nitric oxide-binding molecule with guanylate
cyclase activity in vitro. FEBS Lett 585:2693–2697
Müller M, Mentel M, van Hellemond JJ, Henze K, Woehle C, Gould SB, Yu RY, van der
Giezen M, Tielens AG, Martin WF (2012) Biochemistry and evolution of anaerobic energy
metabolism in eukaryotes. Microbiol Mol Biol Rev 76:444–495
Murthy UM, Wecker MS, Posewitz MC, Gilles-Gonzalez MA, Ghirardi ML (2012) Novel FixL
homologues in Chlamydomonas reinhardtii bind heme and O2. FEBS Lett 586:4282–4288
Mus F, Dubini A, Seibert M, Posewitz MC, Grossman AR (2007) Anaerobic acclimation in
Chlamydomonas reinhardtii: anoxic gene expression, hydrogenase induction, and metabolic
pathways. J Biol Chem 282:25475–25486
Mustroph A, Lee SC, Oosumi T, Zanetti ME, Yang H, Ma K, Yaghoubi-Masihi A, Fukao T,
Bailey-Serres J (2010) Cross-kingdom comparison of transcriptomic adjustments to
low-oxygen stress highlights conserved and plant-specific responses. Plant Physiol
152:1484–1500
Nakamura T, Lipton SA (2013) Emerging role of protein-protein transnitrosylation in cell signal-
ing pathways. Antioxid Redox Signal 18:239–249
Nardini M, Pesce A, Milani M, Bolognesi M (2007) Protein fold and structure in the truncated
(2/2) globin family. Gene 398:2–11
Noth J, Krawietz D, Hemschemeier A, Happe T (2013) Pyruvate: ferredoxin oxidoreductase is
coupled to light-independent hydrogen production in Chlamydomonas reinhardtii. J Biol
Chem 288:4368–4377
Page MD, Kropat J, Hamel PP, Merchant SS (2009) Two Chlamydomonas CTR copper trans-
porters with a novel Cys-Met motif are localized to the plasma membrane and function in
copper assimilation. Plant Cell 21:928–943
Påhlman AK, Granath K, Ansell R, Hohmann S, Adler L (2001) The yeast glycerol 3-phosphatases
Gpp1p and Gpp2p are required for glycerol biosynthesis and differentially involved in the
cellular responses to osmotic, anaerobic, and oxidative stress. J Biol Chem 276:3555–3563
194 A. Hemschemeier
Pape M, Lambertz C, Happe T, Hemschemeier A (2012) Differential expression of the

Chlamydomonas [FeFe]-hydrogenase-encoding HYDA1 gene is regulated by the copper
response regulator1. Plant Physiol 159:1700–1712
Park YJ, Yoo CB, Choi SY, Lee HB (2006) Purifications and characterizations of a ferredoxin and
its related 2-oxoacid:ferredoxin oxidoreductase from the hyperthermophilic archaeon,
Sulfolobus solfataricus P1. J Biochem Mol Biol 39:46–54
Peden EA, Boehm M, Mulder DW, Davis R, Old WM, King PW, Ghirardi ML, Dubini A (2013)
Identification of global ferredoxin interaction networks in Chlamydomonas reinhardtii. J Biol
Chem 288:35192–35209
Perazzolli M, Dominici P, Romero-Puertas MC, Zago E, Zeier J, Sonoda M, Lamb C, Delledonne
M (2004) Arabidopsis nonsymbiotic hemoglobin AHb1 modulates nitric oxide bioactivity.
Plant Cell 16:2785–2794
Perazzolli M, Romero-Puertas MC, Delledonne M (2006) Modulation of nitric oxide bioactivity
by plant haemoglobins. J Exp Bot 57:479–488
Pesce A, Bolognesi M, Nardini M (2013) The diversity of 2/2 (truncated) globins. Adv Microb
Physiol 63:49–78
Peters JW, Schut GJ, Boyd ES, Mulder DW, Shepard EM, Broderick JB, King PW, Adams MW
(2015) [FeFe]- and [NiFe]-hydrogenase diversity, mechanism, and maturation. Biochim
Biophys Acta 1853:1350–1369
Philipps G, Krawietz D, Hemschemeier A, Happe T (2011) A pyruvate formate lyase-deficient
Chlamydomonas reinhardtii strain provides evidence for a link between fermentation and
hydrogen production in green algae. Plant J 66:330–340
Philipps G, Happe T, Hemschemeier A (2012) Nitrogen deprivation results in photosynthetic
hydrogen production in Chlamydomonas reinhardtii. Planta 235:729–745
Planchet E, Kaiser WM (2006) Nitric oxide production in plants: facts and fictions. Plant Signal
Behav 1:46–51
Posewitz MC, King PW, Smolinski SL, Zhang L, Seibert M, Ghirardi ML (2004a) Discovery of
two novel radical S-adenosylmethionine proteins required for the assembly of an active
[Fe] hydrogenase. J Biol Chem 279:25711–25720
Posewitz MC, Smolinski SL, Kanakagiri S, Melis A, Seibert M, Ghirardi ML (2004b) Hydrogen
photoproduction is attenuated by disruption of an isoamylase gene in Chlamydomonas
reinhardtii. Plant Cell 16:2151–2163
Poyton RO, Castello PR, Ball KA, Woo DK, Pan N (2009) Mitochondria and hypoxic signaling: a
new view. Ann N Y Acad Sci 1177:48–56
Quinn JM, Merchant S (1995) Two copper-responsive elements associated with the
Chlamydomonas Cyc6 gene function as targets for transcriptional activators. Plant Cell
7:623–628
Quinn JM, Nakamoto SS, Merchant S (1999) Induction of coproporphyrinogen oxidase in
Chlamydomonas chloroplasts occurs via transcriptional regulation of Cpx1 mediated by copper
response elements and increased translation from a copper deficiency-specific form of the
transcript. J Biol Chem 274:14444–14454
Quinn JM, Barraco P, Eriksson M, Merchant S (2000) Coordinate copper- and oxygen-responsive
Cyc6 and Cpx1 expression in Chlamydomonas is mediated by the same element. J Biol Chem
275:6080–6089
Quinn JM, Eriksson M, Moseley JL, Merchant S (2002) Oxygen deficiency responsive gene
expression in Chlamydomonas reinhardtii through a copper-sensing signal transduction path-
way. Plant Physiol 128:463–471
Quinn JM, Kropat J, Merchant S (2003) Copper response element and Crr1-dependent Ni2+-
responsive promoter for induced, reversible gene expression in Chlamydomonas reinhardtii.
Ragsdale SW (2003) Pyruvate ferredoxin oxidoreductase and its radical intermediate. Chem Rev
103:2333–2346
Rassaf T, Flogel U, Drexhage C, Hendgen-Cotta U, Kelm M, Schrader J (2007) Nitrite reductase

function of deoxymyoglobin: oxygen sensor and regulator of cardiac energetics and function.
Circ Res 100:1749–1754
Raymond J, Blankenship RE (2004) Biosynthetic pathways, gene replacement and the antiquity of
life. Geobiology 2:199–203
Raymond J, Segre D (2006) The effect of oxygen on biochemical networks and the evolution of
complex life. Science 311:1764–1767
Reeder BJ (2010) The redox activity of hemoglobins: from physiologic functions to pathologic
mechanisms. Antioxid Redox Signal 13:1087–1123
Rice SL, Boucher LE, Schlessman JL, Preimesberger MR, Bosch J, Lecomte JT (2015) Structure
of Chlamydomonas reinhardtii THB1, a group 1 truncated hemoglobin with a rare histidine-
lysine heme ligation. Acta Crystallogr F Struct Biol Commun 71:718–725
Riese M, H€ohmann S, Saedler H, Münster T, Huijser P (2007) Comparative analysis of the
SBP-box gene families in P. patens and seed plants. Gene 401:28–37
Robinson CM, Ohh M (2014) The multifaceted von Hippel-Lindau tumour suppressor protein.
FEBS Lett 588:2704–2711
Rodgers KR, Lukat-Rodgers GS (2005) Insights into heme-based O2 sensing from structure-
function relationships in the FixL proteins. J Inorg Biochem 99:963–977
Sainz M, Pérez-Rontomé C, Ramos J, Mulet JM, James EK, Bhattacharjee U, Petrich JW, Becana
M (2013) Plant hemoglobins may be maintained in functional form by reduced flavins in the
nuclei, and confer differential tolerance to nitro-oxidative stress. Plant J 76:875–887
Sakihama Y, Nakamura S, Yamasaki H (2002) Nitric oxide production mediated by nitrate
reductase in the green alga Chlamydomonas reinhardtii: an alternative NO production pathway
in photosynthetic organisms. Plant Cell Physiol 43:290–297
Santolini J (2011) The molecular mechanism of mammalian NO-synthases: a story of electrons
and protons. J Inorg Biochem 105:127–141
Sanz-Luque E, Oca~na-Calahorro F, Llamas A, Galván A, Fernández E (2013) Nitric oxide controls
nitrate and ammonium assimilation in Chlamydomonas reinhardtii. J Exp Bot 64:3373–3383
Sanz-Luque E, Oca~na-Calahorro F, de Montaigu A, Chamizo-Ampudia A, Llamas A, Galván A,
Fernández E (2015) THB1, a truncated hemoglobin, modulates nitric oxide levels and nitrate
reductase activity. Plant J 81:467–479
Sawers RG (2005) Formate and its role in hydrogen production in Escherichia coli. Biochem Soc
Trans 33:42–46
Sch€oneberg T, Kloos M, Brüser A, Kirchberger J, Sträter N (2013) Structure and allosteric
regulation of eukaryotic 6-phosphofructokinases. Biol Chem 394:977–993
Schr€oder F, Lisso J, Müssig C (2011) EXORDIUM-LIKE1 promotes growth during low carbon
availability in Arabidopsis. Plant Physiol 156:1620–1630
Semenza GL (2004) Hydroxylation of HIF-1: oxygen sensing at the molecular level. Physiology
19:176–182
Semenza GL (2012) Hypoxia-inducible factors: mediators of cancer progression and targets for
cancer therapy. Trends Pharmacol Sci 33:207–214
Serpa V, Vernal J, Lamattina L, Grotewold E, Cassia R, Terenzi H (2007) Inhibition of AtMYB2
DNA-binding by nitric oxide involves cysteine S-nitrosylation. Biochem Biophys Res
Commun 361:1048–1053
Shisler KA, Broderick JB (2014) Glycyl radical activating enzymes: structure, mechanism, and
substrate interactions. Arch Biochem Biophys 546:64–71
Smagghe BJ, Trent JT 3rd, Hargrove MS (2008) NO dioxygenase activity in hemoglobins is
ubiquitous in vitro, but limited by reduction in vivo. PLoS One 3:e2039
Smagghe BJ, Hoy JA, Percifield R, Kundu S, Hargrove MS, Sarath G, Hilbert JL, Watts RA,
Dennis ES, Peacock WJ, Dewilde S, Moens L, Blouin GC, Olson JS, Appleby CA (2009)
Review: Correlations between oxygen affinity and sequence classifications of plant hemoglo-
bins. Biopolymers 91:1083–1096
196 A. Hemschemeier
Sommer F, Kropat J, Malasarn D, Grossoehme NE, Chen X, Giedroc DP, Merchant SS (2010) The
CRR1 nutritional copper sensor in Chlamydomonas contains two distinct metal-responsive
domains. Plant Cell 22:4098–4113
Stairs CW, Roger AJ, Hampl V (2011) Eukaryotic pyruvate formate lyase and its activating
enzyme were acquired laterally from a Firmicute. Mol Biol Evol 28:2087–2099
Stark BC, Dikshit KL, Pagilla KR (2011) Recent advances in understanding the structure,
function, and biotechnological usefulness of the hemoglobin from the bacterium Vitreoscilla.
Biotechnol Lett 33:1705–1714
Steinbeck J, Nikolova D, Weingarten R, Johnson X, Richaud P, Peltier G, Hermann M,
Magneschi L, Hippler M (2015) Deletion of Proton Gradient Regulation 5 (PGR5) and
PGR5-Like 1 (PGRL1) proteins promote sustainable light-driven hydrogen production in
Chlamydomonas reinhardtii due to increased PSII activity under sulfur deprivation. Front
Plant Sci 6:892
Steinbüchel A, Müller M (1986) Glycerol, a metabolic end product of Trichomonas vaginalis and
Tritrichomonas foetus. Mol Biochem Parasitol 20:45–55
Stern AM, Zhu J (2014) An introduction to nitric oxide sensing and response in bacteria. Adv Appl
Microbiol 87:187–220
Steunou AS, Bhaya D, Bateson MM, Melendrez MC, Ward DM, Brecht E, Peters JW, Kühl M,
Grossman AR (2006) In situ analysis of nitrogen fixation and metabolic switching in unicellular
thermophilic cyanobacteria inhabiting hot spring microbial mats. Proc Natl Acad Sci U S A
103:2398–2403
St€ohr C, Stremlau S (2006) Formation and possible roles of nitric oxide in plant roots. J Exp Bot
57:463–470
Strenkert D, Schmollinger S, Sommer F, Schulz-Raffelt M, Schroda M (2011) Transcription
factor-dependent chromatin remodeling at heat shock and copper-responsive promoters in
Stripp ST, Goldet G, Brandmayr C, Sanganas O, Vincent KA, Haumann M, Armstrong FA,
Happe T (2009) How oxygen attacks [FeFe] hydrogenases from photosynthetic organisms.
Sturms R, DiSpirito AA, Fulton DB, Hargrove MS (2011a) Hydroxylamine reduction to ammo-
nium by plant and cyanobacterial hemoglobins. Biochemistry (Mosc) 50:10829–10835
Sturms R, DiSpirito AA, Hargrove MS (2011b) Plant and cyanobacterial hemoglobins reduce
nitrite to nitric oxide under anoxic conditions. Biochemistry (Mosc) 50:3873–3878
Taabazuing CY, Hangasky JA, Knapp MJ (2014) Oxygen sensing strategies in mammals and
bacteria. J Inorg Biochem 133:63–72
Tada Y, Spoel SH, Pajerowska-Mukhtar K, Mou Z, Song J, Wang C, Zuo J, Dong X (2008) Plant
immunity requires conformational changes of NPR1 via S-nitrosylation and thioredoxins.
Science 321:952–956
Tanaka R, Kobayashi K, Masuda T (2011) Tetrapyrrole metabolism in Arabidopsis thaliana.
Arabidopsis Book 9:e0145
Tavares CP, Vernal J, Delena RA, Lamattina L, Cassia R, Terenzi H (2014) S-nitrosylation
influences the structure and DNA binding activity of AtMYB30 transcription factor from
Arabidopsis thaliana. Biochim Biophys Acta 1844:810–817
Terashima M, Petroutsos D, Hüdig M, Tolstygina I, Trompelt K, Gäbelein P, Fufezan C, Kudla J,
Weinl S, Finazzi G, Hippler M (2012) Calcium-dependent regulation of cyclic photosynthetic
electron transfer by a CAS, ANR1, and PGRL1 complex. Proc Natl Acad Sci U S A
109:17717–17722
Terauchi AM, Lu SF, Zaffagnini M, Tappa S, Hirasawa M, Tripathy JN, Knaff DB, Farmer PJ,
Lemaire SD, Hase T, Merchant SS (2009) Pattern of expression and substrate specificity of
chloroplast ferredoxins from Chlamydomonas reinhardtii. J Biol Chem 284:25867–25878
Thannickal VJ (2009) Oxygen in the evolution of complex life and the price we pay. Am J Respir
Cell Mol Biol 40:507–510
Tilleman L, Germani F, De Henau S, Geuens E, Hoogewijs D, Braeckman BP, Vanfleteren JR,
Moens L, Dewilde S (2011) Globins in Caenorhabditis elegans. IUBMB Life 63:166–174
Tiso M, Tejero J, Kenney C, Frizzell S, Gladwin MT (2012) Nitrite reductase activity of
nonsymbiotic hemoglobins from Arabidopsis thaliana. Biochemistry (Mosc) 51:5285–5292
Todd BL, Stewart EV, Burg JS, Hughes AL, Espenshade PJ (2006) Sterol regulatory element
binding protein is a principal regulator of anaerobic gene expression in fission yeast. Mol Cell
Biol 26:2817–2831
Totzeck M, Hendgen-Cotta UB, Rammos C, Petrescu AM, Meyer C, Balzer J, Kelm M, Rassaf T
(2012) Assessment of the functional diversity of human myoglobin. Nitric Oxide 26:211–216
Tsygankov A, Kosourov S, Seibert M, Ghirardi ML (2002) Hydrogen photoproduction under
continuous illumination by sulfur-deprived, synchronous Chlamydomonas reinhardtii cultures.
Int J Hydrog Energy 27:1239–1244
Tun NN, Santa-Catarina C, Begum T, Silveira V, Handro W, Floh EI, Scherer GF (2006) Poly-
amines induce rapid biosynthesis of nitric oxide (NO) in Arabidopsis thaliana seedlings. Plant
Cell Physiol 47:346–354
Underbakke ES, Iavarone AT, Chalmers MJ, Pascal BD, Novick S, Griffin PR, Marletta MA
(2014) Nitric oxide-induced conformational changes in soluble guanylate cyclase. Structure
22:602–611
Urzica EI, Casero D, Yamasaki H, Hsieh SI, Adler LN, Karpowicz SJ, Blaby-Haas CE, Clarke SG,
Loo JA, Pellegrini M, Merchant SS (2012) Systems and trans-system level analysis identifies
conserved iron deficiency responses in the plant lineage. Plant Cell 24:3921–3948
van Dongen JT, Licausi F (2015) Oxygen sensing and signaling. Annu Rev Plant Biol 66:345–367
van Lis R, Baffert C, Couté Y, Nitschke W, Atteia A (2013) Chlamydomonas reinhardtii
chloroplasts contain a homodimeric pyruvate:ferredoxin oxidoreductase that functions with
FDX1. Plant Physiol 161:57–71
Vázquez-Limón C, Hoogewijs D, Vinogradov SN, Arredondo-Peter R (2012) The evolution of
land plant hemoglobins. Plant Sci 191-192:71–81
Vigeolas H, Hühn D, Geigenberger P (2011) Nonsymbiotic hemoglobin-2 leads to an elevated
energy state and to a combined increase in polyunsaturated fatty acids and total oil content
when overexpressed in developing seeds of transgenic Arabidopsis plants. Plant Physiol
155:1435–1444
Vignais PM, Billoud B (2007) Occurrence, classification, and biological function of hydrogenases:
an overview. Chem Rev 107:4206–4272
Vinogradov SN, Moens L (2008) Diversity of globin function: enzymatic, transport, storage, and
sensing. J Biol Chem 283:8773–8777
Vinogradov SN, Fernández I, Hoogewijs D, Arredondo-Peter R (2011) Phylogenetic relationships
of 3/3 and 2/2 hemoglobins in Archaeplastida genomes to bacterial and other eukaryote
hemoglobins. Mol Plant 4:42–58
Vinogradov SN, Bailly X, Smith DR, Tinajero-Trejo M, Poole RK, Hoogewijs D (2013a)
Microbial eukaryote globins. Adv Microb Physiol 63:391–446
Vinogradov SN, Tinajero-Trejo M, Poole RK, Hoogewijs D (2013b) Bacterial and archaeal
globins – a revised perspective. Biochim Biophys Acta 1834:1789–1800
Volgusheva A, Kukarskikh G, Krendeleva T, Rubin A, Mamedov F (2015) Hydrogen
photoproduction in green algae Chlamydomonas reinhardtii under magnesium deprivation.
RSC Adv 5:5633–5637
Wagner AF, Frey M, Neugebauer FA, Schäfer W, Knappe J (1992) The free radical in pyruvate
formate-lyase is located on glycine-734. Proc Natl Acad Sci U S A 89:996–1000
Wei L, Derrien B, Gautier A, Houille-Vernes L, Boulouis A, Saint-Marcoux D, Malnoë A,
Rappaport F, de Vitry C, Vallon O, Choquet Y, Wollman FA (2014) Nitric oxide-triggered
remodeling of chloroplast bioenergetics and thylakoid proteins upon nitrogen starvation in
198 A. Hemschemeier
Weits DA, Giuntoli B, Kosmacz M, Parlanti S, Hubberten HM, Riegler H, Hoefgen R, Perata P,
van Dongen JT, Licausi F (2014) Plant cysteine oxidases control the oxygen-dependent branch
of the N-end-rule pathway. Nat Commun 5:3425
Whitney LA, Loreti E, Alpi A, Perata P (2011) Alcohol dehydrogenase and hydrogenase transcript
fluctuations during a day-night cycle in Chlamydomonas reinhardtii: the role of anoxia. New
Phytol 190:488–498
Willam C, Nicholls LG, Ratcliffe PJ, Pugh CW, Maxwell PH (2004) The prolyl hydroxylase
enzymes that act as oxygen sensors regulating destruction of hypoxia-inducible factor alpha.
Adv Enzym Regul 44:75–92
Wilson ID, Neill SJ, Hancock JT (2008) Nitric oxide synthesis and signalling in plants. Plant Cell
Environ 31:622–631
Wimalasekera R, Villar C, Begum T, Scherer GF (2011) COPPER AMINE OXIDASE1 (CuAO1)
of Arabidopsis thaliana contributes to abscisic acid- and polyamine-induced nitric oxide
biosynthesis and abscisic acid signal transduction. Mol Plant 4:663–678
Wimalasekera R, Schaarschmidt F, Angelini R, Cona A, Tavladoraki P, Scherer GF (2015)
POLYAMINE OXIDASE2 of Arabidopsis contributes to ABA mediated plant developmental
processes. Plant Physiol Biochem 96:231–240
Winger JA, Derbyshire ER, Lamers MH, Marletta MA, Kuriyan J (2008) The crystal structure of
the catalytic domain of a eukaryotic guanylate cyclase. BMC Struct Biol 8:42
Winkler M, Hemschemeier A, Gotor C, Melis A, Happe T (2002) [Fe]-hydrogenases in green
algae: photo-fermentation and hydrogen evolution under sulfur deprivation. Int J Hydrog
Energy 27:1431–1439
Winkler M, Kuhlgert S, Hippler M, Happe T (2009) Characterization of the key step for light-
driven hydrogen evolution in green algae. J Biol Chem 284:36620–36627
Winter G, Todd CD, Trovato M, Forlani G, Funck D (2015) Physiological implications of arginine
metabolism in plants. Front Plant Sci 6:534
Wolfe AJ (2005) The acetate switch. Microbiol Mol Biol Rev 69:12–50
Wood PM (1978) Interchangeable copper and iron proteins in algal photosynthesis. Studies on
plastocyanin and cytochrome c-552 in Chlamydomonas. Eur J Biochem 87:9–19
Wykoff DD, Davies JP, Melis A, Grossman AR (1998) The regulation of photosynthetic electron
transport during nutrient deprivation in Chlamydomonas reinhardtii. Plant Physiol
117:129–139
Yamasaki K, Kigawa T, Inoue M, Tateno M, Yamasaki T, Yabuki T, Aoki M, Seki E, Matsuda T,
Nunokawa E, Ishizuka Y, Terada T, Shirouzu M, Osanai T, Tanaka A, Seki M, Shinozaki K,
Yokoyama S (2004) A novel zinc-binding motif revealed by solution structures of
DNA-binding domains of Arabidopsis SBP-family transcription factors. J Mol Biol 337:49–63
Yang J, Naik SG, Ortillo DO, Garcı́a-Serres R, Li M, Broderick WE, Huynh BH, Broderick JB
(2009) The iron-sulfur cluster of pyruvate formate-lyase activating enzyme in whole cells:
cluster interconversion and a valence-localized [4Fe-4S]2+ state. Biochemistry (Mosc)
48:9234–9241
Yang W, Catalanotti C, D’Adamo S, Wittkopp TM, Ingram-Smith CJ, Mackinder L, Miller TE,
Heuberger AL, Peers G, Smith KS, Jonikas MC, Grossman AR, Posewitz MC (2014) Alter-
native acetate production pathways in Chlamydomonas reinhardtii during dark anoxia and the
dominant role of chloroplasts in fermentative acetate production. Plant Cell 26:4499–4518
Yang W, Wittkopp TM, Li X, Warakanont J, Dubini A, Catalanotti C, Kim RG, Nowack EC,
Mackinder LC, Aksoy M, Page MD, D’Adamo S, Saroussi S, Heinnickel M, Johnson X,
Richaud P, Alric J, Boehm M, Jonikas MC, Benning C, Merchant SS, Posewitz MC, Grossman
AR (2015) Critical role of Chlamydomonas reinhardtii ferredoxin-5 in maintaining membrane
structure and dark metabolism. Proc Natl Acad Sci U S A 112:14978–14983
Zagorec M, Labbe-Bois R (1986) Negative control of yeast coproporphyrinogen oxidase synthesis
by heme and oxygen. J Biol Chem 261:2506–2509
Zagorec M, Buhler JM, Treich I, Keng T, Guarente L, Labbe-Bois R (1988) Isolation, sequence, and
regulation by oxygen of the yeast HEM13 gene coding for coproporphyrinogen oxidase. J Biol
Chem 263:9718–9724
Zhang L, Hach A, Wang C (1998) Molecular mechanism governing heme signaling in yeast: a
higher-order complex mediates heme regulation of the transcriptional activator HAP1. Mol
Cell Biol 18:3819–3828
Zhang LP, Mehta SK, Liu ZP, Yang ZM (2008) Copper-induced proline synthesis is associated
with nitric oxide generation in Chlamydomonas reinhardtii. Plant Cell Physiol 49:411–419
Zones JM, Blaby IK, Merchant SS, Umen JG (2015) High-resolution profiling of a synchronized
diurnal transcriptome from Chlamydomonas reinhardtii reveals continuous cell and metabolic
differentiation. Plant Cell 27:2743–2769
Chlamydomonas: Regulation Toward Metal
Deficiencies
Eugen I. Urzica
Abstract The green alga, Chlamydomonas reinhardtii, is an ideal organism to

study cellular responses related to metal deficiencies. The biology of C. reinhardtii
is relevant to both animals and photosynthetic organisms, since many genes are
derived from the common plant–animal ancestor. By studying C. reinhardtii,
important questions in trace metal homeostasis have been answered; however,
many aspects remain to be discovered. To cope with the effects of metal deficien-
cies or excess, C. reinhardtii has developed mechanisms to tightly regulate metal
homeostasis. Here we describe the C. reinhardtii requirements for trace metals, the
intracellular distribution of these micronutrients, and their assimilation mecha-
nisms. We further discuss the impact of trace metals deficiencies on the metabolism
and how the regulation is achieved.
1 Introduction
Although transition metals are essential for life, they could also be toxic. The same
chemical reactivity used for specific reactions could damage the macromolecules
when it is present in excess. Therefore, the organisms have developed mechanisms
that help to maintain the intracellular homeostasis and control the nutrient intra-
cellular levels. The nutrient assimilation pathways are induced at low nutrient
concentrations and turned off at high nutrient concentrations. Metal homeostasis
serves to ensure that the metal ions are accessible and the apoproteins only interact
with the right metal.
Metal ions are simple protein cofactors, and copper, zinc, iron, and manganese,
in particular, can play a role in many and often essential reactions within the cell.
To utilize metal ions as catalysts is imperative for the cell to overcome the unique
challenge of metal specificity and selectively. The interaction between a protein
and a different metal is generally unproductive, and with few exceptions, proteins
E.I. Urzica (*)

Institute of Plant Biology and Biotechnology, Westfaelische Wilhelms Universitaet, Muenster,
48143 Muenster, Germany

202 E.I. Urzica
have evolved to exploit the properties of a specific metal. However, many

metalloproteins bind Cu2þ with higher affinity than they do bind Zn2þ, followed
by Fe2þ and then Mn2þ (Williams 2001). To ensure that each protein binds the
correct metal and to exclude the “wrong” one, the cells have developed specific
mechanisms to avoid mismetalation. When an imbalance between metal availabil-
ity and apoprotein abundance occurs, mismetalation is inevitable. In eukaryotes, an
additional mechanism to maintain metal homeostasis is the storage of metals in
intracellular organelles. Plant and yeast vacuoles are well-established organelles to
sequester and mobilize metals (Martinoia et al. 2007, 2012). More recently, other
compartments like acidocalcisomes and other lysosome-related organelles emerged
as important players of metal homeostasis (Blaby-Haas and Merchant 2014; Hong-
Hermesdorf et al. 2014).
Transition metals due to the capacity to reversibly change their oxidation states
are often found as cofactors in many enzymes. C. reinhardtii as a photosynthetic
organism uses many metals in its photosynthetic and respiratory electron chains. In
the chloroplast many enzymes are present that require metals as cofactors. For
example, the photosynthetic electron chain requires the use of manganese, iron, and
copper. Several other metal-containing enzymes are localized in the chloroplast like
Mn-dependent enzymes (MnSOD3), Zn-dependent carbonic anhydrases (CAH8),
and many Fe-dependent enzymes (e.g., FeSOD, ADH1, FDX1–6, or fatty acid
desaturases like FAB2). Carotenoid and chlorophyll biosynthesis, two pathways
that take place in the chloroplast, are also requiring several metal-dependent
enzymes, mostly being Fe-containing proteins. Likewise, mitochondrial respiratory
electron chain requires the use of many Fe-dependent proteins (subunits of
Complexes I, II, III, and IV), the Cu-dependent cytochrome oxidase, and the
Mn-dependent MnSOD2.
The green alga, C. reinhardtii, is an ideal organism to study cellular responses
to metal deficiencies, since its biology is relevant to both animals and photosyn-
thetic organisms, many genes being derived from the plant–animal common
ancestor (Merchant et al. 2007). Advantages of using C. reinhardtii as a model
organism include the possibility of growth in a defined medium of inorganic salts,
where the metal content is more easily controlled and buffered (Merchant et al.
2006). C. reinhardtii possesses a well-characterized compartmentalization of
metal metabolism (i.e., the chloroplast for photosynthesis and the mitochondria
for respiration). Both the photosynthetic and respiratory electron chains are rich in
metals ions.
In this chapter, we will describe the requirements of the green alga C. reinhardtii
for micronutrients (Fe, Cu, Zn, and Mn) and detail their key functions in the
metabolism. Hereafter, the nutrient assimilation pathways, the members of the
intracellular metals trafficking, and the potential metal-binding chaperones will
be described. We will review the impact of nutrient deficiency and the acclimation
mechanisms acting at the organelle, cellular, and organism levels to preserve the
photosynthetic and respiratory functions under nutrient deficiency.
Chlamydomonas: Regulation Toward Metal Deficiencies 203
2 Iron Deficiency and Regulation
2.1 Iron Nutrition
Based on the expression of sentinel genes, chlorophyll content, growth, and sensi-
tivity to high light, four stages of iron nutrition were defined in C. reinhardtii. Iron
replete, with 20 μM Fe in the medium, corresponds to the iron content of standard
laboratory growth medium (Harris 2009). The second stage is iron deficiency with
around 1–3 μM Fe (depending on the strain) when the cells are preparing for the
onset of iron limitation by upregulating iron transporters and adjusting their bio-
chemistry to minimize iron utilization, but their chlorophyll content is not or only
marginally affected. Fluorescence kinetics and low-temperature fluorescence stud-
ies indicate an impact on PSI light harvesting as well as electron transfer (Moseley
et al. 2002a). Iron-limited cultures (with iron concentrations bellow 0.5 μM Fe) are
visibly chlorotic and show an N-terminal processing of LHCA3 which correlates
with the drop in the excitation energy transfer efficiency between LHCI and PSI as
evidenced by low-temperature fluorescence emission spectroscopy (Moseley et al.
2002a; Naumann et al. 2005). The effect on chlorophyll biosynthesis visualized by
chlorosis could be attributed to a di-iron aerobic cyclase encoded by CHL27 in
chlorophyll biosynthesis (Tottey et al. 2003). Finally, in the iron-excess situation
(200 μM Fe), the cells are phenotypically indistinguishable from iron-replete cells
at normal light intensities but are sensitive to excess excitation energy (500 μmol
photons m2 s1) (Long and Merchant 2008). Even though the high-affinity iron-
uptake system is downregulated under iron-excess situation, it has been shown that
C. reinhardtii cells hyperaccumulate iron under both photoheterotrophic and pho-
toautotrophic conditions (Terauchi et al. 2010). The iron is most likely entering the
cells using the low-affinity pathway, evidenced by the increased IRT1 transcript
levels (see below) (Long and Merchant 2008).
2.2 Iron Assimilation
Iron-deficient C. reinhardtii cells assimilate iron from environment primarily using

a high-affinity pathway that is common to the iron-uptake strategy I in
non-graminaceous plants (reduction strategy) and to the one described in baker’s
yeast Saccharomyces cerevisiae. This high-affinity reduction iron-uptake system in
C. reinhardtii comprises a ferric reductase (FRE1) and a multicopper ferroxidase
(FOX1) that provides the iron in the right oxidation state to be imported into the cells
by the FTR1 permease (La Fontaine et al. 2002; Allen et al. 2007a; Kosman 2003;
Philpott 2006). Two additional ZIP family members (IRT1 and IRT2) that showed
an increased expression specifically in iron-deficient cells (Allen et al. 2007a;
204 E.I. Urzica
Hanikenne 2008) might be involved in low-affinity uptake of ferrous iron. In the

high-affinity iron assimilation pathway, FRE1 is reducing the ferric iron (Fe3þ) to
ferrous iron (Fe2þ). The soluble Fe2þ produced by the FRE1 ferric reductase is
reoxidized by the plasma membrane ferroxidase (FOX1), and the Fe3þ produced by
FOX1 serves as a substrate for the ferric permease FTR1 (Table 1). An important
feature of this high-affinity iron acquisition system is that Fe3þ alone cannot serve as
a substrate for uptake by FTR1. It has been shown in yeast that the permeation of iron
is coupled to ferroxidation via a substrate channeling mechanism in which the Fe3þ
substrate of Ftr1p is handed off directly from the ferroxidase Fet3p (Terzulli and
Kosman 2009, 2010). Residues involved in iron channeling from Fet3p to Ftr1p have
been identified in both proteins. It is most likely that the same mechanism is taking
place also in the green alga C. reinhardtii (Chen et al. 2008).
C. reinhardtii grown under low-iron nutrition showed induced transcript and
protein levels of two algal-specific periplasmic proteins, FEA1 and FEA2. It has
been proposed that these two proteins might play a role in concentrating the iron
ions in the vicinity of the iron transporters. Overexpression of C. reinhardtii FEA1
in S. cerevisiae and A. thaliana showed that the protein can facilitate ferrous (Fe2þ)
uptake. C. reinhardtii FEA1 can complement the irt1 mutant in A. thaliana, as well
as Δftr1 mutant in S. cerevisiae. Moreover, it has been demonstrated that FEA1
specifically facilitates the uptake of iron, since the FEA1 protein does not increase
sensitivity to toxic concentrations of competing nonferrous metals nor facilitate
their (cadmium) accumulation (Narayanan et al. 2011).
The low-affinity iron uptake in C. reinhardtii comprises two members of the ZIP
family of transporters, IRT1 and IRT2 (Allen et al. 2007a). They are similar to the
IRT1/2 from A. thaliana and have been shown that in C. reinhardtii, the IRT1/2
mRNA levels are upregulated in response to iron deficiency (Allen et al. 2007a;
Urzica et al. 2012). In non-graminaceous plants, iron uptake involves the reduction of
Fe3þ to Fe2þ by the plasma membrane ferrireductase FRO2, followed by the import
of ferrous iron into the roots by IRT1. Iron uptake in A. thaliana is preceded by the
solubilization of iron mainly mediated by the root plasma membrane Hþ-ATPase,
AHA2, which pumps protons resulting in rhizosphere acidification (Brumbarova
et al. 2015; Jeong and Guerinot 2009; Santi and Schmidt 2009).
Grasses acquire iron using the chelation mechanism (Strategy II), in which
phytosiderophores (PS) such as mugineic acids are secreted and released to chelate
Fe3þ. The PS–Fe3þ chelates are then transported into the roots via the yellow stripe-
like (YSL) transporters (Curie et al. 2009). Grasses can also take up Fe2þ in
addition to Fe3þ–PS chelates. Rice, a Strategy II plant, and its wild relatives are
well adapted for growth under submerged conditions, in which Fe2þ is more
abundant than Fe3þ. However, unlike Strategy I in non-graminaceous plants,
neither Hþ-ATPase nor ferrireductase activities are induced under iron deficiency.
Ishimaru et al. found that Oryza sativa encodes two IRT transporters (OsIRT1 and
OsIRT2), both being localized at the plasma membrane. OsIRT1 and OsIRT2 are
induced under low-iron nutrition, and both can rescue the growth defects of a yeast
iron-uptake mutant suggesting that OsIRT1 and OsIRT2 are involved in the uptake
of Fe2þ. This probably reflects an adaptation to flooded rice paddies, where Fe2þ is
Table 1 Known and putative proteins involved in iron assimilation and distribution of
intracellular iron
Transcript Gene
name name Defline Domain
Iron assimilation
Cre04. FRE1 Ferric-chelate reductase/ Ferric reductase-like transmem-
g227400. oxidoreductase brane component, FAD-binding
t1.2 domain; ferric reductase
NAD-binding domain
Cre09. FOX1 Multicopper ferroxidase Multicopper oxidase
g393150.
t1.2
Cre03. FTR1 Iron permease, membrane Iron permease FTR1 family
g192050. protein
t1.1
Cre12. FEA1 Iron-assimilating protein 1 Low iron-inducible periplasmic
g546550. protein
t1.1
Cre12. FEA2 Iron-assimilating protein 2 Low iron-inducible periplasmic
g546600. protein
t1.1
Cre12. IRT1 Iron-nutrition-responsive ZIP ZIP zinc transporter
g530400. family transporter
t1.2
Cre12. IRT2 Iron-nutrition-responsive ZIP ZIP zinc transporter
g530350. family transporter
t1.1
Intracellular iron transport
Cre12. TEF22 DOMON domain, cytochrome DOMON domain, eukaryotic cyto-
g546500. b561/ferric reductase trans- chrome b561
t1.2 membrane domain
Cre05. Putative ferric reductase like Ferric reductase-like transmem-
g241400. transmembrane component brane component, FAD-binding
t1.1 domain
Cre16. MFL1 Mitoferrin-like protein Mitochondrial carrier protein
g695950.
t1.2
Cre05. NRAMP4 Natural resistance-associated Natural resistance-associated mac-
g248300. macrophage domain protein rophage protein
t1.1
Cre02. CVL1 Similar to yeast CCC1 and VIT family
g099500. plant VIT1
t1.1
Cre02. CVL2 Similar to yeast CCC1 and VIT family
g107550. plant VIT1
t1.2
Cre16. FPN1 Similar to ferroportin Ferroportin1 (FPN1)
g687000.
t1.1
(continued)
206 E.I. Urzica
Table 1 (continued)
Transcript Gene
Cre12. FTX1 Frataxin Frataxin-like domain
g538350.
t1.1
Cre11. PIC1 PIC1 permease Protein of unknown function
g467759. (DUF3611)
t1.1
Ferritins
Cre09. FER1 Pre-apoferritin Ferritin-like domain
g387800.
t1.2
Cre13. FER2 Ferritin subunit Ferritin-like domain
g574500.
t1.1
Cre01. Ferritin-like domain protein Ferritin2 domain
g033300. (ferritin2)
t1.2
Unknown function
Cre12. FOX2 Multicopper oxidase Multicopper oxidase
g531200.
t1.1
Cre03. RBOL1 Respiratory burst oxidase Ferric reductase-like transmem-
g188300. brane component, FAD-binding
t1.1 domain
Cre03. RBOL2 Respiratory burst oxidase Ferric reductase-like transmem-
g188400. brane component, FAD-binding
t1.1 domain
more abundant than Fe3þ owing to reduced levels of oxygen (Ishimaru et al. 2006;
Thomine and Vert 2013; Walker and Connolly 2008).
2.3 Intracellular Iron Distribution
After its import into Chlamydomonas cell, iron most likely binds to diverse low-
molecular-weight biological ligands forming the labile iron pool. From this labile
pool, iron is distributed to the chloroplast, mitochondria where it is needed for
photosynthesis and respiration, and for Fe–S clusters and heme synthesis or is
sequestered into the vacuole. Iron-deficient C. reinhardtii cells upregulate several
gene-encoding transporters with the potential to function in intracellular metal
distribution. These include a transporter of the natural resistance-associated macro-
phage proteins NRAMP4, Cre16.g687000 protein with sequence homology to plant
and mammalian ferroportins, CVL1 and CVL2 which are two putative transporters
similar to vacuolar plant VIT1 and yeast CCC1-like transporters, and two putative
ferric reductases (TEF22 and Cre05.g241400) (Table 1) (Urzica et al. 2012).
The NRAMP proteins are conserved from bacteria to humans, and they catalyze
the Hþ-dependent transport of divalent metal ions, such as Mn2þ, Fe2þ, Co2þ, Zn2þ
, Ni2þ, or Cd2þ (Courville et al. 2006; Nevo and Nelson 2006). The yeast genome
codes for three NRAMP transporters (Sm1p, Smf2p, and Smf3p), of which Smf3p
is vacuolar membrane localized and its expression is regulated by iron nutrition,
whereas mammals have two, SLC11A1 and SLC11A2 (Portnoy et al. 2000; Singh
et al. 2007). Mammalian SCL11A2 (also called DCT1/DMT1) functions in iron
import into enterocytes, after reduction of ferric iron by ferric reductase at the
apical membrane, and in Fe2þ transport from the endosome during the transferrin
cycle (Andrews 2000; Riedel et al. 1995). NRAMP3 and NRAMP4 in Arabidopsis
are both induced by iron deficiency (Thomine et al. 2000) and function to mobilize
iron from vacuoles during seed germination (Lanquar et al. 2005). The
C. reinhardtii genome codes for four NRAMPs (NRAMP1, NRAMP2, RET1,
and NRAMP4). C. reinhardtii NRAMP4 is induced by iron deficiency under both
photoheterotrophic and photoautotrophic conditions, and these changes in
NRAMP4 mRNA abundances are specific to iron-deficient/iron-limited cells,
whereas the NRAMP1 and NRAMP2 genes are induced specifically in
manganese-starved cells (Urzica et al. 2012). NRAMP4 from C. reinhardtii is
more closely related to Arabidopsis NRAMP3/NRAMP4 and mammalian DCT1
than to the other C. reinhardtii NRAMP proteins. Therefore, it seems likely that
C. reinhardtii NRAMP4 is involved in remobilization of vacuolar iron stores
needed for essential processes (photosynthesis and mitochondrial respiration) dur-
ing low-iron nutrition. A compartment called the acidocalcisome has been
described in C. reinhardtii (Ruiz et al. 2001). This compartment contains
polyphosphate and metals and is a specialized vacuolar structure based on proteo-
mic analysis of Cyanidioschyzon merolae acidocalcisomes that identified
V-ATPase subunits (Yagisawa et al. 2009). In addition, at least two candidate
metal transporters, including a protein related to S. cerevisiae Ccc1p and a cation
diffusion facilitator family member (putative Zn transporter), were described.
CVL1 and CVL2 are two proteins related to S. cerevisiae Ccc1p and Arabidopsis
VIT1 that are involved in the iron export from the vacuole into the cytosol (Kim
et al. 2006; Li et al. 2001). Although the increasing transcript levels of
C. reinhardtii CCVL1/CCVL2 seem counterintuitive, it is possible that under
iron deficiency, they function to only transiently store the potentially toxic iron
released from degraded or damaged iron–sulfur proteins into the vacuoles prior to
its redistribution to intracellular compartments. A similar pattern of expression and
function has been documented for a vacuolar zinc transporter in S. cerevisiae
(ZRC1) (MacDiarmid et al. 2003).
Cre16.g687000 encodes a ferroportin-like protein (FPN1), and similar increas-
ing expression profiles during iron deficiency have been observed for a plant
ferroportin IREG2/FPN2, whereas another plant ferroportin IREG3/MAR1 is
downregulated under iron deficiency in A. thaliana (Buckhout et al. 2009;
Colangelo and Guerinot 2004; Long et al. 2010; Kong and Yang 2010; Zheng
208 E.I. Urzica
et al. 2009). A. thaliana FPN2 is localized to vacuolar membranes and MAR1 to the
plastid envelope membranes. The proteins can apparently transport divalent cations
like Fe2þ, Co2þ, and Ni2þ (Conte et al. 2009; Morrissey et al. 2009; Schaaf et al.
2006). Since the overexpression of MAR1 in A. thaliana confers chlorosis which
can be rescued by excess iron, it has been suggested that MAR1 has a function in
iron import into the chloroplasts. In addition MAR1 can transport multiple
aminoglycoside antibiotics (Conte et al. 2009). On the other hand, FPN2 is playing
a role in sequestering other divalent cations to the vacuole. The latter function is
necessary in iron-deficient cells because members of the ZIP family (like IRT1/
IRT2, which are induced) are not as selective for iron as is the FTR1/FOX1 pathway
and may bring in unwanted, potentially toxic ions. For instance, plant IRT proteins
are known to transport Cd2þ (Connolly et al. 2002).
Another induced gene in iron-deficient/iron-limited C. reinhardtii is Cre05.
g241400 and encodes for a ferric reductase-like protein. This putative
ferrireductase could function to reduce intracellular ferric to ferrous prior to
transport into the vacuole or the chloroplast, by analogy to Fre6p in yeast or
FRO7 in Arabidopsis (Jeong et al. 2008; Singh et al. 2007).
C. reinhardtii genome also encodes for three cytochrome b561 family proteins
(TEF22, Cre14.g609900, and Cre13.g586600). TEF22 and Cre14.g609900 possess
a DOMON domain fused to a cytochrome b561 ferric reductase domain and are more
related to mammalian FRRS-like ferric reductases than they are to the plant homo-
logs (Urzica et al. 2012). Mouse, rat, human, and Drosophila melanogaster SDR2
(FRRS1) are indeed functional ferric reductases, and mouse SDR2 is also regulated
by iron (Vargas et al. 2003). Expression of mammalian duodenal cytochrome
b (Dcytb), which generates the Fe2þ used by DCT1/DMT1, is likewise regulated
by iron nutrition (McKie 2008; McKie et al. 2001), and two other mammalian
cytochrome b561 homologs from chromaffin granules and lysosomes function as
ascorbate-dependent ferric reductases (Fleming et al. 1997; Fleming and Kent 1991;
Njus et al. 1987; Su and Asard 2006; Zhang et al. 2006). These cytochrome b561
ferric reductases each possess four conserved histidine residues involved in coordi-
nation of two heme molecules and conserved sites for ascorbate and
monodehydroascorbate binding (Su and Asard 2006; Takeuchi et al. 2004; Trost
et al. 2000). The C. reinhardtii proteins retain the conserved residues, making them
likely to be true ferric reductases (Urzica et al. 2012). Proteomic studies indicated
that TEF22 is in the mitochondrion (Allmer et al. 2006; Atteia et al. 2009) suggesting
that TEF22 might be a ferric reductase involved in supplying ferrous iron for
mitochondrial respiratory complexes. Cre14.g609900 may function together with
FRE1 at the plasma membrane, whereas Cre13.g586600, whose
monodehydroascorbate and ascorbate binding sites are well conserved, might be
involved in ascorbate regeneration from monodehydroascorbate at the plasma
membrane or vacuolar membrane (Urzica et al. 2012). Members of the mitochon-
drial solute carrier (MSC) family can transport multiple substrates across the inner
mitochondrial membrane. Some of them are involved in iron import into mitochon-
dria, like MIT from rice (Bashir et al. 2011a, b), Mrs3p and Mrs4p in yeast
(Froschauer et al. 2009; Muhlenhoff et al. 2003), or mitoferrins 1 and 2 in zebrafish
and mouse (Shaw et al. 2006). C. reinhardtii encodes for a mitoferrin homolog
(MFL1) that is potentially involved in iron import into the algal mitochondria
(Table 1) (Blaby-Haas and Merchant 2012).
Another key player in the iron homeostasis is played by the ferritin. Due to its
ability to store large quantities of iron, ferritin is the major, and perhaps only, iron
storage protein (Koorts and Viljoen 2007; Theil 1987). Ferritin is a multimeric
complex, consisting of 24 subunits that form a shell around a core that can hold up
to 4500 Fe(III) atoms as an insoluble iron–oxyhydroxide mineral (Harrison and
Arosio 1996; Theil 1987). When iron is needed, reduction leads to release of the
metal from the complex, but the mechanism is not yet fully understood (Harrison
and Arosio 1996). Even though its three-dimensional structure is conserved, mam-
malian and plant ferritins differ in their subunit composition and the cellular
localization. In mammals, the ferritin complex is localized in the cytosol (Harrison
and Arosio 1996) and is composed of the H and L subunits in a tissue-dependent
stoichiometry. The H chain carries ferroxidase active sites that oxidize ferrous to
ferric iron, a prerequisite for mineralization in the core (Chasteen 1998). The L
chain that is present only in vertebrates does not have a ferroxidase site but is able to
form a complex and bind iron at neutral but not acidic pH (Levi et al. 1989).
Therefore changes in the ratio of H/L subunits, e.g., in response to iron nutrition or
in particular cell types, can affect the iron storage capability of ferritin (Koorts and
Viljoen 2007). In vascular plants, ferritin is located in the plastids rather than in the
cytosol and is the source of iron for de novo synthesis of the cytochromes and FeS
proteins in the photosynthetic apparatus during chloroplast development (Lobréaux
and Briat 1991).
Recently, ferritin was also found in plant mitochondria, and it was suggested that
this might be a consequence of dual targeting of one of the preproteins (Zancani
et al. 2004). Although ferritin is encoded by a multigene family in plants [four FER
genes in Arabidopsis (Petit et al. 2001); three in Lupinus luteus (Strozycki et al.
2010)], the subunits are all of one type with a ferroxidase active site and charac-
teristics of both the H and the L chains (Wade et al. 1993). During the early stages
of plant development, ferritin is mostly detected in the nongreen plastids of seeds
and developing organs, such as young leaves, where it serves as an iron pool
(Lobréaux and Briat 1991), whereas in the chloroplasts, it is only found during
senescence (Buchanan-Wollaston and Ainsworth 1997). The elevated protein level
sequestered iron at the expense of the iron-rich photosynthetic machinery and led to
an iron-deficient phenotype of the chloroplasts, evidenced by an increase in root
ferric reductase activity and in leaf iron content (Van Wuytswinkel et al. 1998).
Two genes FER1 and FER2 encoding ferritin subunits were identified in the
C. reinhardtii genome with 49% identity between the FER1 and FER2 subunits.
Both ferritin subunits are plastid localized, but FER1 is quantitatively recovered in
soluble extracts of cells, while FER2 is found associated with the particulate
fraction. Both FER1 and FER2 transcripts are increased in abundance as iron
nutrition is decreased, but the pattern for each gene is distinct (Long et al. 2008;
Urzica et al. 2012). The increased abundance of FER1 mRNAs in iron deficiency
(La Fontaine et al. 2002) is counterintuitive for an iron storage protein, and it has
210 E.I. Urzica
been suggested that plastid ferritin1 plays a role in buffering iron or holding it
transiently as it was released from PSI by degradation (Moseley et al. 2002a).
However, the iron content of the FER1 complex is decreased suggesting that
increased expression results in increased capacity for iron binding in the chloroplast
of iron-limited cells, which supports a role for FER1 as an iron buffer (Long et al.
2008). Busch et al. showed that there is a strong correlation between the induction
of the FER1 protein levels and the degree of PSI degradation under iron-limited
conditions. The PSI level can be fully restored within 24 h after iron repletion at the
expense of the accumulated ferritin, indicating that the ferritin-stored iron allows
fast adjustment of the photosynthetic apparatus with respect to iron availability
(Busch et al. 2008). Reducing the amount of FER1 protein using RNAi results in a
significant delay in the degradation of PSI under iron limitation, and these strains
are more susceptible to photooxidative stress under high-light conditions. This
suggests that it plays also a protective role under photooxidative stress conditions
(Busch et al. 2008).
On the other hand, FER2 protein levels are decreased in iron-deprived cells,
suggesting that there is an iron-nutrition-responsive regulation at the translational
or posttranslational level for FER2. Partial purification of the FER1 complex
indicates that the two ferritins are associated in distinct complexes but they do
not coassemble. The ratio of FER1 to FER2 is 70:1 in iron-replete cells, suggesting
a more dominant role of FER1 in iron homeostasis (Long et al. 2008).
2.3.1 Photoautotrophic Versus Photoheterotrophic Growth Conditions
C. reinhardtii cells can grow autotrophically on CO2 and heterotrophically using

acetate. In either case, metabolism depends on abundant iron proteins, the autotro-
phic growth on proteins of the photosynthetic apparatus in the chloroplast whereas
the heterotrophic growth on mitochondrial respiratory complex proteins. The
responses of Chlamydomonas cells to iron-deficient conditions are specific depend-
ing on the trophic status. Chlamydomonas cells grown photoheterotrophically under
iron-limited conditions grow faster than the autotrophic grown cells. As already
pointed out, photoheterotrophic cells suppress photosynthesis while maintaining
relatively high rates of respiration, whereas the photoautotrophic cells still perform
efficiently photosynthesis while respiration is lost (Hohner et al. 2013; Terauchi
et al. 2010). Iron-limited, photoheterotrophically grown Chlamydomonas cells have
less chlorophyll, lower quantum efficiency of PSII (Fv/Fm), and lower
non-photochemical quenching (NPQ) compared to phototrophically iron-limited
grown cells (Hohner et al. 2013; Naumann et al. 2007; Terauchi et al. 2010). Also
degradation of PSI subunits is faster in cells grown under photoheterotrophic iron-
limited conditions. Iron limitation has a major impact on respiratory rates in cells
grown in iron-limited conditions and in the presence of acetate. Respiratory oxygen
rates do not decrease significantly under photoheterotrophic low-iron conditions,
and comparative proteomics showed that the subunits of the respiratory complexes
were only slightly diminished or even increased under similar conditions but
strongly diminished under autotrophic low-iron nutrition (Hohner et al. 2013;

Naumann et al. 2007; Terauchi et al. 2010). This indicates a hierarchical
reallocation of iron from one organelle to another in a Chlamydomonas cell
which is dependent on the metabolic status of the cell.
Interestingly, when the Chlamydomonas cells are cultivated phototrophically,
they accumulate approximately twice as much iron when compared to
photoheterotrophically grown cells in both iron-replete and iron-limited conditions
(Terauchi et al. 2010). It is possible that the excess iron is stored inside ferritin or
inside the vacuoles and will become available when needed. This is supported by
the delayed degradation of PSI and by the delayed induction of the iron-uptake
system (e.g., ferroxidase) (Busch et al. 2008; Terauchi et al. 2010).
2.4 Iron Sparing and Recycling
Cells are able to acclimate to poor iron nutrition by activating an iron-sparing

mechanism. Cells could decide that some iron-binding proteins are not synthesized,
synthesized at a much lower rate, or eventually degraded before they can compete
for iron. Once iron is assimilated or remobilized from cellular stores, it can further
be selectively used for less dispensable iron-dependent functions, such as DNA
repair/synthesis at the expense of other nonessential iron-dependent processes
(Sanvisens et al. 2011).
The common examples of iron sparing have been described in bacteria and yeast.
Iron sparing in Escherichia coli is accomplished with RhyB (a small regulatory
RNA), in Bacillus subtilis with the sRNA FsrA, and with the RNA-binding protein
Cth2 in Saccharomyces cerevisiae. Common targets include succinate dehydroge-
nase (Complex II), aconitase (tricarboxylic acid cycle enzyme containing a [4Fe–
4S]), and glutamate synthase (glutamate and nitrogen metabolism, two [4Fe–4S]
and one [3Fe–4S]). Although analogous sRNAs or RNA-binding proteins remain to
be discovered in plants and algae, iron-responsive microRNAs have been found in
Arabidopsis (Kong and Yang 2010).
While iron sparing is well characterized in model bacterial and fungal organ-
isms, how this strategy occurs and how it is regulated in plants and algae are
relatively limited. Several plant transcriptome studies in low-iron nutrition revealed
transcripts with reduced abundance in response to poor iron nutrition and among
them are several mRNAs encoding iron-dependent proteins, and these are potential
targets of iron sparing. In Arabidopsis these genes encode cytochrome P450s
(heme), peroxidases (heme), Rieske [Fe–S] domain-containing proteins, 2OG–Fe
(II) oxygenase family proteins, and the iron-dependent superoxide dismutase,
FSD1, in the plastid (Dinneny et al. 2008; Long et al. 2010).
In C. reinhardtii, several transcripts of iron-containing proteins were shown to
be repressed in a recent transcriptome study using RNA-Seq on cells grown in
iron-sufficient (20 μM Fe), iron-deficient (1 μM Fe), and iron-limited (0.25 μM Fe)
media in the presence (photoheterotrophic) or absence of acetate
212 E.I. Urzica
(photoautotrophic) (Urzica et al. 2012). During the iron-limited state, several

examples of putative iron-sparing events were found for both trophic conditions.
During photoheterotrophic iron-limited growth, at least 25 transcripts encoding
known or putative iron-dependent proteins are reduced twofold or more in abun-
dance. The most highly decreased of these are linked to anaerobic growth,
including hybrid-cluster proteins (HCP4, 28-fold; HCP1 20-fold), pyruvate–ferre-
doxin oxidoreductase (PRF1, 15-fold), hydrogenase assembly factors (HYDG,
15-fold; HYDEF, 11-fold), and ferredoxin–sulfite reductase (SIR1, 6-fold) (Urzica
et al. 2012). Under the photoautotrophic iron-limited condition, at least ten
transcripts encoding known or putative iron-dependent proteins are reduced in
abundance. Seven transcripts encoding iron-dependent proteins are reduced in
both iron-limited trophic conditions; these transcripts may represent core iron-
sparing targets. Correlated reduction in protein abundance was confirmed using
two independent quantitative proteomic studies for a protein similar to MitoNEET
([2Fe–2S]), the classic ferredoxin PETF ([2Fe–2S]), aconitase (4Fe–4S]), the
hybrid-cluster protein HCP3 ([4Fe–4S], [4Fe–3O–3S]), glutamate synthase,
NADH-dependent (GSN1, [3Fe–4S]), and an adenylylphosphosulfate reductase
(APR1, [4Fe–4S]) (Hohner et al. 2013; Hsieh et al. 2013; Urzica et al. 2012).
On the other hand, there are few examples where the iron-containing proteins are
degraded in response to low-iron nutrition as another mechanism to economize
iron. Moseley et al. observed that in C. reinhardtii the subunits of the iron-rich PSI
and cytochrome b6f complexes are reduced in abundance within 24 h of iron
starvation (Moseley et al. 2002a). The transcripts of these subunits, however, had
roughly the same pattern of expression regardless of iron supply, leading the
authors to conclude that reduction in complex abundance is not due to absence of
transcript. The reduction in PSI and cytochrome b6f could be due to programmed
iron-deficiency-responsive proteolysis, since the authors also found protease activ-
ity specific to iron-starved cells, which was responsible for degrading some light-
harvesting proteins (Moseley et al. 2002a).
A comparison between the transcriptome and proteome study revealed a
decrease in the protein content of several iron-containing proteins but without
any evident downregulation of the corresponding transcripts. These are
L-ascorbate peroxidase (APX4, heme), 4-hydroxy-3-methylbut-2-enyl diphosphate
reductase (IDS1, [4Fe–4S]), and 3-isopropylmalate dehydratase (LEU1L, [4Fe–
4S]). The decrease of these proteins is either a response to poor iron nutrition-
induced proteolysis or they may degrade because of the lack of the cofactor (Hsieh
et al. 2013; Urzica et al. 2012).
While iron-sparing mechanism is supported by downregulation of gene expres-
sion, transcript degradation, and initiation of proteolysis, there are also some
indispensable iron-dependent proteins that are preferentially maintained. This
involves the increase in gene expression that leads to an induction of the
corresponding mRNA levels in response to low-iron nutrition. Also mechanisms
that prevent proteolysis and increasing the translation of the prioritized protein
might be involved as well. On the other hand, the absence of mutilation could lead
to no enzymatic activity, which could have a regulatory feedback on the respective

pathway leading to increase in transcript levels.
In C. reinhardtii, the best-characterized example of prioritizing one
Fe-dependent enzyme over others is the chloroplast Fe-dependent superoxide
dismutase (FeSOD). Page et al. showed that there is a hierarchical allocation of
iron to chloroplast proteins. For example, the protein levels of cytochrome f,
magnesium protoporphyrin monomethyl ester cyclase (a di-iron cyclase), and
ferredoxin1 (FDX1) were severely reduced in response to iron limitation, whereas
the protein abundance of FeSOD could be maintained under the same conditions.
This raised the question how FeSOD is preferentially maintained when other
Fe-containing proteins are all reduced in abundance. By monitoring the abundance
of these chloroplast Fe-containing proteins over 5 days of iron starvation, the
authors could demonstrate that FeSOD and the other Fe-dependent chloroplast
proteins decreased in abundance in the first 24 h of Fe starvation, but while the
protein levels of cytochrome f, di-iron cyclase, and FDX1 were constantly decreas-
ing over the 5-day period, the FeSOD protein abundance started to recover and was
fully restored to normal levels by day 5. Not only the protein levels were recovered
but also the FeSOD activity, suggesting that FeSOD in the first 24 h is degraded due
to lack of iron, but FeSOD is preferentially resynthesized and metalated over the
other chloroplast Fe-containing proteins (Page et al. 2012).
2.5 Regulation of Iron-Deficiency Responses
To date there is no information on how iron homeostasis is regulated in

C. reinhardtii. In higher plants, a number of transcription factors have been
identified as components of the iron signaling response, including FIT1/FER,
POPEYE (PYE), bHLH115, and ILR3 (Bauer et al. 2007; Brumbarova et al.
2008; Colangelo and Guerinot 2004; Ling et al. 2002). In addition, there is a
posttranslational component involving an E3-ubiquitin ligase BRUTUS (BTS)
(Long et al. 2010; Selote et al. 2015).
In the last years, several bHLH proteins have been identified as regulators of
iron-deficiency responses in plants. In tomato, the bHLH protein, FER, was the first
characterized factor that controls the iron-deficiency responses, and its mutant
failed to activate iron acquisition strategy I (Ling et al. 2002). FIT1, a homolog
of FER in A. thaliana, is required for the regulation of ferric-chelate reductase
activity and Fe transport into the plant root, and its mutation was lethal when plants
were grown in normal soils (Colangelo and Guerinot 2004; Jakoby et al. 2004;
Yuan et al. 2005). Studies have indicated that FIT is dually regulated by iron
starvation: at the transcriptional level, FIT is induced by iron deficiency (Colangelo
and Guerinot 2004; Jakoby et al. 2004; Yuan et al. 2005), whereas at the posttran-
scriptional level, FIT is actively destabilized and degraded by the 26S proteasome
during iron limitation (Meiser et al. 2011). Both FIT and bHLH38/39/100/101
function as positive regulators. In contrast, PYE was identified as a negative
214 E.I. Urzica
regulator of iron-deficiency responses in A. thaliana (Long et al. 2010). PYE

transcript levels were elevated under low-iron conditions, and its direct targets
are several genes involved in metal homeostasis, such as nicotianamine synthase
4 (NAS4), FRO3, and zinc-induced facilitator 1 (ZIF1). In a pye-1 mutant, the
expression of these target genes is significantly upregulated in iron-deficient con-
ditions, suggesting that PYE functions as a negative regulator. It is unclear how
plants perceive iron status and transmit signals to downstream pathways. In mam-
mals, FBXL5 functions as an iron sensor and contains a hemerythrin domain (HHE)
for Fe binding and an F-box domain for ubiquitination and degradation of IRP2.
The proteins IRP1 and IRP2 govern cellular iron homeostasis by regulation of
translation and stability of mRNAs involved in iron homeostasis (Salahudeen et al.
2009; Vashisht et al. 2009). Interestingly the A. thaliana BRUTUS (BTS) and its
rice orthologs, HRZ1 and HRZ2, possess HHE domains for binding Fe. Although
they lack an F-box domain similar to that in FBXL5, BTS and HRZ1/HRZ2 have
RING domains that can mediate the ubiquitination reaction. Functional analysis
revealed that BTS and HRZ1/HRZ2 negatively regulate iron-deficiency responses
in plants (Kobayashi et al. 2013; Selote et al. 2015). Given that BTS and HRZ1/
HRZ2 are structurally and functionally similar to FBXL5, they are thought to be
potential iron sensors in plants. Although no substrates for HRZ1/HRZ2 have been
found, it is established that BTS interacts with three PYE-like proteins (bHLH104,
bHLH105/ILR3, and bHLH115) and facilitates 26S proteasome-mediated degra-
dation of bHLH105/IAA-LEUCINE RESISTANT3 (ILR3) and bHLH115 in the
absence of Fe in vitro (Selote et al. 2015). Recently, Zhang et al. (2015) revealed
that bHLH104 and bHLH105 positively regulate iron homeostasis by directly
activating transcription of bHLH38/39/100/101 and PYE. Recent studies demon-
strated that bHLH34 and bHLH104 play major roles in regulating iron homeostasis
by activating the transcription of bHLH38/39/100/101 under iron-deficiency con-
ditions (Li et al. 2016).
In C. reinhardtii most of the highly regulated genes (FOX1, FTR1, FEA1, and
MSD3) are controlled at transcriptional level (Allen et al. 2007a; Page et al. 2012;
Urzica et al. 2012). Using deletion analyses, two different iron response elements
(FeREs) were identified in the 50 -flanking regions of the FOX1, FTR1, FEA1, and
ATX1 genes (Deng and Eriksson 2007; Fei and Deng 2007; Fei et al. 2009, 2010).
These distinctive cis-acting elements are CAC(G/A)CG in the promoter regions of
FOX1, FEA2, or FER1 and TG(G/C)CA in the promoters of FEA1, FRE1, and
ATX1. An unsupervised promoter analysis on different iron-deficiency gene sets
showed that for short promoters, CACGCG is the most overrepresented 6mer, both
for genes induced under both photoheterotrophic and photoautotrophic conditions
(Urzica et al. 2012). Besides the FeREs, little else is known about the regulation of
iron-deficient responses in C. reinhardtii. The C. reinhardtii Cre24.g770450 pro-
tein is similar to the A. thaliana group IV transcription factors (ILR3, bHLH34,
bHLH104, and bHLH115), and its expression is increased in iron-poor conditions
in both photoheterotrophically and photoautotrophically grown cells. Several other
transcription factors are induced at the transcript level under iron-deficient and iron-
limited conditions, and among them three MYB-like transcription factors (MYB4,
MYB16, and Cre12.g514400) were identified (Urzica et al. 2012). MYB-like
transcription factors have been previously associated with iron deficiency in plants,
where they might function as regulators of iron-deficiency responses (Chen et al.
2006; Ogo et al. 2006; Shen et al. 2008). Whether any of these genes can regulate
the iron-deficiency responses in C. reinhardtii remains to be experimentally
elucidated.
3 Copper Deficiency and Regulation
3.1 Copper Assimilation and Copper Chaperones
Copper can exist in two oxidation states (Cuþ and Cu2þ) and like iron can be found
as a cofactor in many electron transfer proteins and different enzymes such as
cytochrome oxidase, ferroxidase, or CuZn superoxide dismutase; thus copper is an
essential micronutrient for most organisms. Copper homeostasis must be tightly
regulated to maintain proper intracellular levels. Transporters that can import
copper have been identified in several organisms. The S. cerevisiae Ctr1 and Ctr3
are plasma membrane copper transporters with redundant functions; only deletion
of both could abolish the high-affinity copper uptake. The Fe3þ/Cu2þ reductase,
FRE1, is required for maximal copper uptake, indicating that Cuþ is the substrate
for the Ctr1 and Ctr3. The third CTR transporter in baker’s yeast, Ctr2p, plays a role
in mobilization of copper stores from the vacuole under conditions of copper
deficiency (Rees et al. 2004).
CTR type of transporters was also identified in humans and plants. For example,
hCTR1 is transporting Cuþ across the plasma membrane, and deletion of CTR1
homolog in mice is lethal (Lee et al. 2001). Once imported into the cells, copper is
bound to cytosolic chaperones that deliver the metal to target proteins. In
A. thaliana, the CTR-type transporters belong to a six-gene family of copper
transporters (COPT1–6) (Penarrubia et al. 2010; Pilon et al. 2006). Of these,
COPT1 and COPT2 are plasma membrane localized and can fully complement
the Δctr1 growth phenotype in yeast (Sancenon et al. 2003). COPT3 and COPT5
can only partially rescue defective mutants in copper transport, suggesting that they
might be involved in intracellular copper transport. In plants, Cu must also be
distributed to the chloroplast, and in A. thaliana the P-type ATPase transporters
PAA1 and PAA2 translocate Cu across the envelope and thylakoid membranes,
respectively (Abdel-Ghany et al. 2005; Shikanai et al. 2003).
C. reinhardtii genome encodes for four CTR-type transporters (COPT1 and
CTR1–3) (Table 2). Besides the CTR type of transporters, the C. reinhardtii
possesses five candidate copper-transporting P-type ATPases (CTP1–4 and
HMA1) that are potentially involved in intracellular copper transport (Table 2).
In C. reinhardtii the transcript levels of CTR1, CTR2, and CTR3 are highly
upregulated in response to copper deficiency. On the other hand, the abundance
of CTP1–4, COPT1, and HMA1 was not significantly changed in copper-deficient
cells (Castruita et al. 2011; Page et al. 2009).
216 E.I. Urzica
Table 2 Known and putative copper transporters or potentially to be involved in copper

acquisition
Transcript Gene
Cre13. CTR1 CTR-type copper ion Ctr copper transporter family
g570600. transporter
t1.2
Cre10. CTR2 CTR-type copper ion Ctr copper transporter family
t1.1
Cre10. CTR3 Copper transport
g434650. related
t1.1
Cre05. COPT1 CTR-type copper ion Ctr copper transporter family
t1.2
Cre16. CTP1 Heavy-metal- Heavy-metal-associated domain; E1–E2
g682369. transporting ATPase ATPase; haloacid dehalogenase-like hydrolase
t1.1
t1.1
t1.1
g422201. transporting ATPase ATPase
t1.1
Cre17. HMA1 Heavy-metal- E1-E2 ATPase; haloacid dehalogenase-like
g720400. transporting ATPase hydrolase
t1.1
Cre02. CUTA1 Copper-binding pro- CutA1 divalent ion tolerance protein
g082350. tein CutA
t1.1
Cre17. CUTC Copper homeostasis CutC family
g732700. protein cutC homolog
t1.2
Cre09. ATX1 Copper chaperone Heavy-metal-associated domain
g392467.
t1.1
Cre05. PCC1 Copper ATPase Heavy-metal-associated domain
g248600.
t1.2
Once copper is imported into the cell, it has to be incorporated into the major
copper-containing proteins, ferroxidase (FOX1), plastocyanin in the chloroplast
and cytochrome oxidase in the mitochondria. Since these cuproproteins are located
in different cellular compartments, distinct pathways are used for copper delivery.
The plasma membrane-localized ferroxidase has an extracellular active site with six
copper atoms. The copper chaperone ATX1 is predicted to deliver the copper to the
Cuþ-transporting P-type ATPase (CTP1) in the trans-Golgi compartment where
FOX1 is matured (Blaby-Haas and Merchant 2012; Merchant and Bogorad 1986b).
In A. thaliana copper transport into the chloroplasts depends on the HMA
proteins P-type ATPase of Arabidopsis 1 (PAA1 or HMA6) and PAA2
(or HMA8), and analyses of chloroplast copper proteins in the paa1 and paa2
mutants demonstrate that both ATPases are required for copper delivery to plasto-
cyanin (Puig et al. 2007). In C. reinhardtii, plastocyanin, with a single copper at its
active site, is located in the thylakoid lumen, and the copper delivery to this
compartment requires the related Cuþ-transporting ATPases PAA1 and PAA2
(CTP2/Cre10.g424775 and CTP4/Cre10.g422201 in Chlamydomonas) in the enve-
lope and thylakoid membranes, respectively (Pilon et al. 2006). Based on similarity
to Arabidopsis PAA1 and PAA2, the Chlamydomonas protein CTP2 is predicted to
pump copper across the inner membrane, and CTP4 is predicted to pump copper
across the thylakoid membrane. Recently, a plant-specific copper chaperone has
been identified to deliver Cu with specificity to PAA1. This Cu chaperone evolved
early in the plant lineage by alternative-splicing event of the PAA1 pre-mRNA
(Blaby-Haas et al. 2014).
Cytochrome oxidase is localized to the inner mitochondrial membrane and has
three copper atoms associated with integral membrane subunits COX1 and COX2.
In Chlamydomonas, COX2 consists of two domains, a membrane component
COX2A and a soluble extramembrane domain COX2B, whose accumulation is
used as a proxy for the whole complex. Cox17 is most likely involved in Cu
trafficking toward mitochondrial cytochrome c oxidase (COX) as seen in yeast
(Cobine et al. 2006).
3.2 Backup Proteins
Even that C. reinhardtii genome codes for several candidate cuproproteins, the
transcriptome and proteome analyses indicate that the copper quota of the cell is
dependent largely on only a few copper-containing proteins (Castruita et al. 2011).
Plastocyanin is a blue copper protein that is required for photosynthesis and
involved in transferring the electrons from cytochrome b6f complex to PSI
(Merchant and Sawaya 2005). PCY1 mRNA which encodes the plastocyanin in
C. reinhardtii is one of the most abundant transcripts in the cell (top 10 of >17,000
genes), consistent with the abundance of plastocyanin (8 106 molecules per
cell) (Castruita et al. 2011). The PCY1 gene is constitutively expressed, but the
protein accumulates only in the presence of copper in the medium; in copper-
deficient cells, plastocyanin is rapidly degraded (Merchant and Bogorad 1986a, b).
A potential protease involved in plastocyanin degradation is RSEP1, a protein
related to bacterial membrane metalloproteases. RSEP1 expression is tightly regu-
lated by copper nutrition (highly induced in response to copper deficiency) and
dependent on the copper response regulator1 (CRR1) (Castruita et al. 2011). The
218 E.I. Urzica
CYC6 gene which encodes for the heme-containing cyt c6 is transcribed only in
copper-deficient C. reinhardtii cells, and its expression replaces the loss of plasto-
cyanin function, thus reducing the copper quota (Merchant and Bogorad 1986b). A
remarkable feature is that in C. reinhardtii, plastocyanin and cyt c6 are almost
functionally equally efficient in reducing PSI (Hippler et al. 1997).
Other abundant transcripts include FOX1, encoding the copper-containing
ferroxidase required for iron assimilation and hence more heavily expressed in
iron-deficient cells; COX2A and COX2B, encoding one of two copper-binding
subunits of cytochrome oxidase, which is essential for respiration in the mitochon-
dria; and UOX1 encoding urate oxidase, which functions in nitrogen metabolism.
The dominance of plastocyanin over other cuproproteins (e.g., 100-fold higher than
urate oxidase) has been confirmed using quantitative proteomics of soluble
C. reinhardtii fractions (Hsieh et al. 2013).
3.3 Regulation of Copper Homeostasis
Under copper-limiting conditions, to sustain photosynthesis and electron transport,

C. reinhardtii replaces the copper-containing plastocyanin with the heme-
containing cytochrome c6. This replacement is transcriptionally activated via the
copper-responsive elements (CuREs) present in the promoter sequence of CYC6
gene. Responsible for the activation is the copper response regulator 1 (CRR1)
(Kropat et al. 2005; Quinn and Merchant 1995). CRR1 is a member of the plant-
specific squamosa promoter-binding protein (SBP) family of transcription factors.
CRR1 possesses also ankyrin repeats, which are known protein–protein interaction
modules, and a C-terminal Cys-rich region similar to metallothionein (Kropat et al.
2005). In Arabidopsis, the copper-responsive regulator is SPL7 which is the
functional equivalent of CRR1 (Yamasaki et al. 2009). In C. reinhardtii the
CRR1 binds to the CuREs and recognizes the GTAC core of these elements via
its SBP domain (Quinn et al. 2000). The genes required for the acclimation to
copper deficiency, like the assimilatory CTR transporters, Cyt c6, and others, must
possess in their 50 UTRs the CuREs to allow the copper-deficient cells to maintain
the essential metabolic pathways. CRR1 can bind copper ions via the SBP domain,
but the copper-deficiency phenotype can be mimicked by additional Ni2þ ions
which can induce the CRR1 regulon (Blaby-Haas et al. 2016).
Copper response defect 1 (CRD1) and copper target homolog 1 (CTH1) are two
paralogues encoding alternatively regulating oxidative cyclases involved in the
tetrapyrrole biosynthesis (Allen et al. 2008). The pattern of expression of these
two cyclases is reciprocal: CRD1 accumulates in copper-deficient conditions and
hypoxia, whereas CTH1 abundance is increased in copper-sufficient conditions
(Moseley et al. 2002b). Regulation of cyclase accumulation is complex: in
copper-replete conditions, a 2.1 kb CTH1 mRNA is produced, and CTH1 protein
accumulates. On the other hand, in copper deficiency, a 3.1 kb CTH1 mRNA and
the CRD1 mRNA are produced, but only CRD1 protein accumulates (Moseley et al.
2002b). Deletion of CRD1 results in a strong chlorotic phenotype under copper

deficiency due to loss of PSI polypeptides (Moseley et al. 2000, 2002b). In addition
to CRD1, it has been shown that several other genes (Cyt c6 and
coproporphyrinogen oxidase CPX1) are upregulated in both Cu-deficient condi-
tions and hypoxia and are targets of the transcriptional regulator (Eriksson et al.
2004; Quinn et al. 2000, 2002).
Recently, a transcriptome survey of copper-deficient wild-type and crr1–2
mutant cells identified the main CRR1 targets. This study identified 63 CRR1
targets plus another 86 copper-responsive genes (Castruita et al. 2011). Among
the CRR1 targets, several putative plastid proteins could be identified: a highly
conserved protein CGL78, ferredoxins FDX5 and FDX6, and a thylakoid mem-
brane protease RSEP1. As mentioned, RSEP1 might play a role in plastocyanin
degradation. The role of CRR1 target genes under hypoxia is essential for cells,
since the crr1 mutant has a severe growth defect in hypoxic conditions in the light.
Genes known to be important for the copper deficiency response of C. reinhardtii
are activated in hypoxia, and genes known to be responsive to O2 limitation, such as
iron-hydrogenase subunit HYDA1 and pyruvate/ferredoxin oxidoreductase PFR1,
are also induced in copper-deficient cells (Castruita et al. 2011; Eriksson et al. 2004;
Hemschemeier et al. 2013).
4 Other Metals
4.1 Zinc
In addition to iron and copper, zinc is an another essential micronutrient since many
enzymes contain zinc as a cofactor, usually coordinated via the zinc-binding
domains (Andreini et al. 2006). Intracellular zinc content must be regulated to
ensure that zinc-containing proteins can function; therefore, the zinc uptake must be
tightly regulated. The intracellular zinc status controls the expression of low- and
high-affinity transporters at the plasma membrane. Zinc compartmentalization is
also important; specific transporters can sequester zinc in the vacuole (in fungi,
plants), lysosome-related compartments (in Caenorhabditis elegans), or
zincosomes (in mammalian cells) in a situation of excess (Ehrensberger and Bird
2011; Eide 2009; Sinclair and Kramer 2012).
Two families of transporters have been implicated in zinc assimilation and
compartmentalization: the ZIP (Zrt-, Irt-like protein) family and the CDF (cation
diffusion facilitator) family. The ZIP transporters usually play a role in moving
either zinc or iron into the cytoplasm, whereas the CDF type of transporters
functions primarily to move zinc out of the cytoplasm (Blaby-Haas and Merchant
2012). C. reinhardtii genome encodes for 14 members of ZIP family transporters
based on the homology to known plant, yeast, and human transporters (Table 3).
220 E.I. Urzica
Table 3 Known and putative zinc transporters or known to be involved in zinc assimilation and
trafficking
Transcript Gene
Cre03. MTP1 CDF transporter Cation efflux family
g145087.
t1.1
Cre02. ZIL1 ZIP family transporter-like ZIP zinc transporter
g087400.
t1.2
Cre06. ZIL2 ZIP family transporter-like ZIP zinc transporter
g281900.
t1.2
Cre07. ZIP1 ZIP family transporter ZIP zinc transporter
g355100.
t1.2
g576050.
t1.1
Cre03. ZIP3 ZIP family transporter NUDIX domain
g189500.
t1.2
g392060.
t1.1
g299600.
t1.2
Cre07. ZRT1 Zinc-nutrition responsive ZIP zinc transporter
t1.1
t1.2
t1.1
t1.1
t1.1
Cre12. ZCP1 Zinc-responsive COG0523 domain- CobW/HypB/UreG,
g536900. containing protein nucleotide-binding domain
t1.1
Cre02. ZCP2 Zinc-responsive COG0523 domain- CobW/HypB/UreG,
g118400. containing protein nucleotide-binding domain
t1.1
In C. reinhardtii four nutritional zinc conditions have been identified: toxic,

replete, deficient, and limited. Growth is inhibited in zinc-limited and zinc-toxic
cells relative to zinc replete cells, whereas zinc deficiency can only be distinguished
by the accumulation of transcripts encoding ZIP family transporters. In a recent
transcriptome study, the mechanisms to zinc acclimation and the targets of different
zinc nutritional conditions were analyzed (Malasarn et al. 2013). The authors found
out that five ZIP transporters (ZRT1-5) and two potentially zinc chaperones
(ZCP1–2) (zinc-responsive COG0523 domain-containing protein) are significantly
changed in abundance under zinc-limited conditions. In addition, zinc deficiency
has an impact on two other regulatory pathways, the carbon concentrating mech-
anism (CCM) and the nutritional copper regulon. Targets of transcription factor
Ccm1 and various genes coding for carbonic anhydrases are upregulated in zinc
deficiency. As a consequence, Chlamydomonas cells are not able to grow photo-
autotrophically under zinc-limiting conditions. As mentioned above, Crr1 regulon
responds to copper limitation but is also turned on in zinc deficiency, and Crr1 is
required for growth in zinc-limiting conditions. Zinc-deficient cells are functionally
copper deficient, and they hyperaccumulate copper up to 20-fold over normal levels
(Malasarn et al. 2013). The copper accumulates in lysosome-related acidic organ-
elles called acidocalcisomes and it co-localizes with calcium as visualized per
confocal microscopy (Hong-Hermesdorf et al. 2014). Elemental analysis of these
compartments that overaccumulate under zinc-limited conditions revealed
increased Ca and Cu content when isolated from zinc-deficiency conditions. The
copper that hyperaccumulates in the cells under zinc limitation is bioavailable,
since it can be remobilized from the acidic compartments and can be sensed by the
copper-transcriptional regulator CRR1 and used for the synthesis of plastocyanin
(Hong-Hermesdorf et al. 2014).
4.2 Manganese
Manganese is an essential micronutrient for phototrophic growth, since it is present

in the polynuclear cluster in PSII and required for the water-splitting reaction
(Merchant and Sawaya 2005). The main enzymes in algae that use manganese are
the superoxide dismutases (MnSOD). The assimilation of manganese in eukaryotes
is performed by the members of the NRAMP family. In A. thaliana the NRAMP1 is
located at the plasma membrane and induced by manganese deficiency. An nramp1-
1 mutant in A. thaliana has impaired growth and less manganese levels compared to
wild type under limiting manganese concentrations suggesting that is the major
high-affinity manganese transporter (Cailliatte et al. 2010). In addition, the
A. thaliana NRAMP1 transcript is induced also by iron deficiency and fails to
rescue a yeast mutant defective in the FET3 and FET4 ( fet3fet4) iron importers,
suggesting that NRAMP1 can also take up iron (Curie et al. 2000). At least two
other members of the NRAMP family (NRAMP3 and NRAMP4) are involved in
intracellular distribution of manganese in A. thaliana. Both are localized in the
222 E.I. Urzica
Table 4 Known and putative manganese transporters

Gene
Transcript name name Defline Domain
Cre17.g707700. NRAMP1 Natural resistance-associated macrophage NRAMP
t1.2 protein
Cre07.g321951. NRAMP2 Natural resistance-associated macrophage NRAMP
t1.1 protein
Cre03.g160800. MTP2 CDF transporter, membrane protein Cation efflux
t1.2 family
t1.1 family
t1.1 family
t1.1 family
vacuolar membrane, and in addition to manganese release from the vacuole, they
also transport iron (Lanquar et al. 2005, 2010). In C. reinhardtii four members of
the NRAMP family have been identified (NRAMP1, NRAMP2, RET1, and
NRAMP4). NRAMP1 and NRAMP2 are bacterial-like MntH class of Mn–Fe
transporters, while NRAMP4 is similar to the eukaryotic-type AtNRAMP3 and
AtNRAMP4 from Arabidopsis (Blaby-Haas and Merchant 2012).
The members of a second family, cation diffusion facilitator (CDF), are also
predicted to play a role in manganese transport. C. reinhardtii CDF proteins MTP2,
MTP3, and MTP4 are predicted to transport manganese based on phylogenetic
relationships, while MTP2 and MTP5 transcripts are three- and fivefold more
abundant in manganese-limited conditions (Allen et al. 2007b). Under conditions
of manganese deficiency, cells show a slower growth, and the activity of PSII is
compromised (decreased photosynthesis quantum efficiency). The oxygen evolving
enhancer proteins (OEE1–3) are slightly decreased under manganese deprivation,
but they are not localized anymore to the membrane, suggesting that manganese is
mostly required to stabilize the complex on the membrane (Allen et al. 2007b;
Hsieh et al. 2013) (Table 4).
Low-manganese nutrition has an impact on the activity of the major MnSOD in
C. reinhardtii, and the cells are sensitive to peroxide stress, most likely do to the
loss of MnSOD activities, known to possess antioxidant functions. Manganese
deficiency also leads to secondary iron deficiency and contains less intracellular
iron content, which might suggest that mechanisms to reduce iron levels in order to
protect the cells from increased oxidative stress are active (Allen et al. 2007b). A
proteome study of manganese-deficient and manganese-limited cells indicated that
the components of the 20S and 26S proteasomes and the T-complex chaperonin
were increased in low-manganese nutrition relative to the replete situation. This
increase in the proteasome levels suggests an overall increase in the amount of
proteolysis occurring in manganese-deficient cells, possibly due to increased levels
of oxidative damage (Hsieh et al. 2013).
5 Conclusions and Perspective
The micronutrient ions described in this chapter (Fe, Cu, Zn, and Mn) fulfil multiple
key functions in Chlamydomonas reinhardtii cell. In particular the chloroplast and
mitochondria have important requirements for these metals. Recent work revealed
that complex acclimation mechanisms evolved to allow maintenance of the photo-
synthetic function under metals deficiency. Several transcription factors that coor-
dinate the deficiency responses have been identified or proposed to play a role in the
regulation of metal homeostasis. However, further work will be required to deter-
mine how the metal status is sensed in the Chlamydomonas cell and how it is
signaled to other compartments to adapt uptake and trafficking in the cell.
Except for copper, the uptake systems for other metals (e.g., iron, zinc, manga-
nese) in chloroplasts and mitochondria remain to be identified.
Recent studies started to shed light on the interactions between metal homeo-
stases of chloroplasts, mitochondria, and/or vacuoles. For example, copper that
hyperaccumulates in the cells under zinc limitation can be remobilized from the
acidic compartments and can be sensed by the copper-transcriptional regulator
CRR1 and used for the synthesis of plastocyanin indicating that it is bioavailable
(Hong-Hermesdorf et al. 2014).
In conclusion, many open questions remain regarding the metal homeostasis
inside the organelles and the crosstalk of metals between organelles and represent
topical avenues for future investigations.
Acknowledgments The research of EIU is funded by the Deutsche Forschungsgemeinschaft

(Grant no. UR 269/1-1).
References
Abdel-Ghany SE, Muller-Moule P, Niyogi KK, Pilon M, Shikanai T (2005) Two P-type ATPases
are required for copper delivery in Arabidopsis thaliana chloroplasts. Plant Cell 17
(4):1233–1251. doi:10.1105/tpc.104.030452
Allen MD, del Campo JA, Kropat J, Merchant SS (2007a) FEA1, FEA2, and FRE1, encoding two
homologous secreted proteins and a candidate ferrireductase, are expressed coordinately with
FOX1 and FTR1 in iron-deficient Chlamydomonas reinhardtii. Eukaryot Cell 6
(10):1841–1852. doi:10.1128/EC.00205-07
Allen MD, Kropat J, Tottey S, Del Campo JA, Merchant SS (2007b) Manganese deficiency in
Chlamydomonas results in loss of photosystem II and MnSOD function, sensitivity to peroxides,
and secondary phosphorus and iron deficiency. Plant Physiol 143(1):263–277. doi:10.1104/pp.
106.088609
Allen MD, Kropat J, Merchant SS (2008) Regulation and localization of isoforms of the aerobic
oxidative cyclase in Chlamydomonas reinhardtii. Photochem Photobiol 84(6):1336–1342.
doi:10.1111/j.1751-1097.2008.00440.x
Allmer J, Naumann B, Markert C, Zhang M, Hippler M (2006) Mass spectrometric genomic data
mining: novel insights into bioenergetic pathways in Chlamydomonas reinhardtii. Proteomics
6(23):6207–6220
224 E.I. Urzica
Andreini C, Banci L, Bertini I, Rosato A (2006) Zinc through the three domains of life. J Proteome
Res 5(11):3173–3178. doi:10.1021/pr0603699
Andrews NC (2000) Iron homeostasis: insights from genetics and animal models. Nat Rev Genet 1
(3):208–217
Atteia A, Adrait A, Brugiere S, Tardif M, van Lis R, Deusch O, Dagan T, Kuhn L, Gontero B,
Martin W, Garin J, Joyard J, Rolland N (2009) A proteomic survey of Chlamydomonas
reinhardtii mitochondria sheds new light on the metabolic plasticity of the organelle and on
the nature of the alpha-proteobacterial mitochondrial ancestor. Mol Biol Evol 26
(7):1533–1548
Bashir K, Ishimaru Y, Nishizawa NK (2011a) Identification and characterization of the major
mitochondrial Fe transporter in rice. Plant Signal Behav 6(10):1591–1593. doi:10.4161/psb.6.
10.17132
Bashir K, Ishimaru Y, Shimo H, Nagasaka S, Fujimoto M, Takanashi H, Tsutsumi N, An G,
Nakanishi H, Nishizawa NK (2011b) The rice mitochondrial iron transporter is essential for
plant growth. Nat Commun 2:322. doi:10.1038/ncomms1326
Bauer P, Ling HQ, Guerinot ML (2007) FIT, the FER-like iron deficiency induced transcription
factor in Arabidopsis. Plant Physiol Biochem 45(5):260–261
Blaby-Haas CE, Merchant SS (2012) The ins and outs of algal metal transport. Biochim Biophys
Acta 1823(9):1531–1552. doi:10.1016/j.bbamcr.2012.04.010
Blaby-Haas CE, Merchant SS (2014) Lysosome-related organelles as mediators of metal homeo-
stasis. J Biol Chem 289(41):28129–28136. doi:10.1074/jbc.R114.592618
Blaby-Haas CE, Padilla-Benavides T, Stube R, Arguello JM, Merchant SS (2014) Evolution of a
plant-specific copper chaperone family for chloroplast copper homeostasis. Proc Natl Acad Sci
U S A 111(50):E5480–E5487. doi:10.1073/pnas.1421545111
Blaby-Haas CE, Castruita M, Fitz-Gibbon ST, Kropat J, Merchant SS (2016) Ni induces the
CRR1-dependent regulon revealing overlap and distinction between hypoxia and Cu defi-
ciency responses in Chlamydomonas reinhardtii. Metallomics. doi:10.1039/c6mt00063k
Brumbarova T, Matros A, Mock HP, Bauer P (2008) A proteomic study showing differential
regulation of stress, redox regulation and peroxidase proteins by iron supply and the transcrip-
tion factor FER. Plant J 54(2):321–334
Brumbarova T, Bauer P, Ivanov R (2015) Molecular mechanisms governing Arabidopsis iron
uptake. Trends Plant Sci 20(2):124–133. doi:10.1016/j.tplants.2014.11.004
Buchanan-Wollaston V, Ainsworth C (1997) Leaf senescence in Brassica napus: cloning of
senescence related genes by subtractive hybridisation. Plant Mol Biol 33(5):821–834
Buckhout TJ, Yang TJ, Schmidt W (2009) Early iron-deficiency-induced transcriptional changes
in Arabidopsis roots as revealed by microarray analyses. BMC Genomics 10:147
Busch A, Rimbauld B, Naumann B, Rensch S, Hippler M (2008) Ferritin is required for rapid
remodeling of the photosynthetic apparatus and minimizes photo-oxidative stress in response
to iron availability in Chlamydomonas reinhardtii. Plant J 55(2):201–211. doi:10.1111/j.1365-
313X.2008.03490.x
Cailliatte R, Schikora A, Briat JF, Mari S, Curie C (2010) High-affinity manganese uptake by the
metal transporter NRAMP1 is essential for Arabidopsis growth in low manganese conditions.
Plant Cell 22(3):904–917. doi:10.1105/tpc.109.073023
reveals connections between copper nutrition and multiple metabolic steps. Plant Cell 23
(4):1273–1292. doi:10.1105/tpc.111.084400
Chasteen ND (1998) Ferritin. Uptake, storage, and release of iron. Met Ions Biol Syst 35:479–514
Chen YH, Wu XM, Ling HQ, Yang WC (2006) Transgenic expression of DwMYB2 impairs iron
transport from root to shoot in Arabidopsis thaliana. Cell Res 16(10):830–840
Chen JC, Hsieh SI, Kropat J, Merchant SS (2008) A ferroxidase encoded by FOX1 contributes to
iron assimilation under conditions of poor iron nutrition in Chlamydomonas. Eukaryot Cell 7
(3):541–545. doi:10.1128/EC.00463-07
Cobine PA, Pierrel F, Winge DR (2006) Copper trafficking to the mitochondrion and assembly of
copper metalloenzymes. Biochim Biophys Acta 1763(7):759–772. doi:10.1016/j.bbamcr.2006.
03.002
Colangelo EP, Guerinot ML (2004) The essential basic helix-loop-helix protein FIT1 is required
for the iron deficiency response. Plant Cell 16(12):3400–3412
Connolly EL, Fett JP, Guerinot ML (2002) Expression of the IRT1 metal transporter is controlled
by metals at the levels of transcript and protein accumulation. Plant Cell 14(6):1347–1357
Conte S, Stevenson D, Furner I, Lloyd A (2009) Multiple antibiotic resistance in Arabidopsis is
conferred by mutations in a chloroplast-localized transport protein. Plant Physiol 151
(2):559–573. doi:10.1104/pp.109.143487
Courville P, Chaloupka R, Cellier MF (2006) Recent progress in structure-function analyses of
Nramp proton-dependent metal-ion transporters. Biochem Cell Biol 84(6):960–978
Curie C, Alonso JM, Le Jean M, Ecker JR, Briat JF (2000) Involvement of NRAMP1 from
Arabidopsis thaliana in iron transport. Biochem J 347(Pt 3):749–755
Curie C, Cassin G, Couch D, Divol F, Higuchi K, Le Jean M, Misson J, Schikora A, Czernic P,
Mari S (2009) Metal movement within the plant: contribution of nicotianamine and yellow
stripe 1-like transporters. Ann Bot 103(1):1–11. doi:10.1093/aob/mcn207
Deng X, Eriksson M (2007) Two iron-responsive promoter elements control expression of FOX1
in Chlamydomonas reinhardtii. Eukaryot Cell 6(11):2163–2167
Dinneny JR, Long TA, Wang JY, Jung JW, Mace D, Pointer S, Barron C, Brady SM,
Schiefelbein J, Benfey PN (2008) Cell identity mediates the response of Arabidopsis roots to
abiotic stress. Science 320(5878):942–945
Ehrensberger KM, Bird AJ (2011) Hammering out details: regulating metal levels in eukaryotes.
Trends Biochem Sci 36(10):524–531. doi:10.1016/j.tibs.2011.07.002
Eide DJ (2009) Homeostatic and adaptive responses to zinc deficiency in Saccharomyces
cerevisiae. J Biol Chem 284(28):18565–18569. doi:10.1074/jbc.R900014200
Eriksson M, Moseley JL, Tottey S, Del Campo JA, Quinn J, Kim Y, Merchant S (2004) Genetic
dissection of nutritional copper signaling in chlamydomonas distinguishes regulatory and
target genes. Genetics 168(2):795–807. doi:10.1534/genetics.104.030460
Fei X, Deng X (2007) A novel Fe deficiency-responsive element (FeRE) regulates the expression
of atx1 in Chlamydomonas reinharditii. Plant Cell Physiol 48(10):1496–1503
Fei X, Eriksson M, Yang J, Deng X (2009) An Fe deficiency responsive element with a core sequence
of TGGCA regulates the expression of FEA1 in Chlamydomonas reinhardtii. J Biochem 146
(2):157–166
Fei X, Eriksson M, Li Y, Deng X (2010) A novel negative Fe-deficiency-responsive element and a
TGGCA-type-like FeRE control the expression of FTR1 in Chlamydomonas reinhardtii. J Biomed
Biotechnol 2010:790247
Fleming PJ, Kent UM (1991) Cytochrome b561, ascorbic acid, and transmembrane electron
transfer. Am J Clin Nutr 54(6 Suppl):1173S–1178S
Fleming MD, Trenor CC III, Su MA, Foernzler D, Beier DR, Dietrich WF, Andrews NC (1997)
Microcytic anaemia mice have a mutation in Nramp2, a candidate iron transporter gene. Nat
Genet 16(4):383–386
Froschauer EM, Schweyen RJ, Wiesenberger G (2009) The yeast mitochondrial carrier proteins
Mrs3p/Mrs4p mediate iron transport across the inner mitochondrial membrane. Biochim
Biophys Acta 1788(5):1044–1050. doi:10.1016/j.bbamem.2009.03.004
Hanikenne M, Merchant SS, Hamel PP (2008) Transition metal nutrition: a balance between
deficiency and toxicity. The Chlamydomonas sourcebook, vol 2, 2nd edn. Academic, San
Diego
Harris EH (2009) The Chlamydomonas sourcebook, 2nd edn. Academic, San Diego
Harrison PM, Arosio P (1996) The ferritins: molecular properties, iron storage function and
cellular regulation. Biochim Biophys Acta 1275(3):161–203
Hemschemeier A, Casero D, Liu B, Benning C, Pellegrini M, Happe T, Merchant SS (2013)
Copper response regulator1-dependent and -independent responses of the Chlamydomonas
226 E.I. Urzica
reinhardtii transcriptome to dark anoxia. Plant Cell 25(9):3186–3211. doi:10.1105/tpc.113.

115741
Hippler M, Drepper F, Farah J, Rochaix JD (1997) Fast electron transfer from cytochrome c6 and
plastocyanin to photosystem I of Chlamydomonas reinhardtii requires PsaF. Biochemistry 36
(21):6343–6349. doi:10.1021/bi970082c
Hohner R, Barth J, Magneschi L, Jaeger D, Niehues A, Bald T, Grossman A, Fufezan C, Hippler M
(2013) The metabolic status drives acclimation of iron deficiency responses in
Chlamydomonas reinhardtii as revealed by proteomics based hierarchical clustering and
reverse genetics. Mol Cell Proteomics 12(10):2774–2790. doi:10.1074/mcp.M113.029991
Domaille DW, Shirasaki DI, Loo JA, Weber PK, Pett-Ridge J, Stemmler TL, Chang CJ,
Merchant SS (2014) Subcellular metal imaging identifies dynamic sites of Cu accumulation
in Chlamydomonas. Nat Chem Biol 10(12):1034–1042. doi:10.1038/nchembio.1662
micronutrient deficiency in Chlamydomonas reinhardtii. Mol Cell Proteomics 12(1):65–86.
doi:10.1074/mcp.M112.021840
Ishimaru Y, Suzuki M, Tsukamoto T, Suzuki K, Nakazono M, Kobayashi T, Wada Y, Watanabe S,
Matsuhashi S, Takahashi M, Nakanishi H, Mori S, Nishizawa NK (2006) Rice plants take up
iron as an Fe3þ-phytosiderophore and as Fe2þ. Plant J 45(3):335–346. doi:10.1111/j.1365-
313X.2005.02624.x
Jakoby M, Wang HY, Reidt W, Weisshaar B, Bauer P (2004) FRU (BHLH029) is required for
induction of iron mobilization genes in Arabidopsis thaliana. FEBS Lett 577(3):528–534
Jeong J, Guerinot ML (2009) Homing in on iron homeostasis in plants. Trends Plant Sci 14
(5):280–285. doi:10.1016/j.tplants.2009.02.006
Jeong J, Cohu C, Kerkeb L, Pilon M, Connolly EL, Guerinot ML (2008) Chloroplast Fe(III)
chelate reductase activity is essential for seedling viability under iron limiting conditions. Proc
Natl Acad Sci U S A 105(30):10619–10624
Kim SA, Punshon T, Lanzirotti A, Li L, Alonso JM, Ecker JR, Kaplan J, Guerinot ML (2006)
Localization of iron in Arabidopsis seed requires the vacuolar membrane transporter VIT1.
Science 314(5803):1295–1298
Kobayashi T, Nagasaka S, Senoura T, Itai RN, Nakanishi H, Nishizawa NK (2013) Iron-binding
haemerythrin RING ubiquitin ligases regulate plant iron responses and accumulation. Nat
Commun 4:2792. doi:10.1038/ncomms3792
Kong WW, Yang ZM (2010) Identification of iron-deficiency responsive microRNA genes and
cis-elements in Arabidopsis. Plant Physiol Biochem 48(2-3):153–159. doi:10.1016/j.plaphy.
2009.12.008
Koorts AM, Viljoen M (2007) Ferritin and ferritin isoforms I: structure-function relationships,
synthesis, degradation and secretion. Arch Physiol Biochem 113(1):30–54. doi:10.1080/
13813450701318583
Kosman DJ (2003) Molecular mechanisms of iron uptake in fungi. Mol Microbiol 47
(5):1185–1197
Kropat J, Tottey S, Birkenbihl RP, Depege N, Huijser P, Merchant S (2005) A regulator of
nutritional copper signaling in Chlamydomonas is an SBP domain protein that recognizes
the GTAC core of copper response element. Proc Natl Acad Sci U S A 102(51):18730–18735.
doi:10.1073/pnas.0507693102
La Fontaine S, Quinn JM, Nakamoto SS, Page MD, Gohre V, Moseley JL, Kropat J, Merchant S
(2002) Copper-dependent iron assimilation pathway in the model photosynthetic eukaryote
Chlamydomonas reinhardtii. Eukaryot Cell 1(5):736–757
Lanquar V, Lelievre F, Bolte S, Hames C, Alcon C, Neumann D, Vansuyt G, Curie C, Schroder A,
Kramer U, Barbier-Brygoo H, Thomine S (2005) Mobilization of vacuolar iron by AtNRAMP3
and AtNRAMP4 is essential for seed germination on low iron. EMBO J 24(23):4041–4051.
doi:10.1038/sj.emboj.7600864
Lanquar V, Ramos MS, Lelievre F, Barbier-Brygoo H, Krieger-Liszkay A, Kramer U, Thomine S

(2010) Export of vacuolar manganese by AtNRAMP3 and AtNRAMP4 is required for optimal
photosynthesis and growth under manganese deficiency. Plant Physiol 152(4):1986–1999.
doi:10.1104/pp.109.150946
Lee J, Prohaska JR, Thiele DJ (2001) Essential role for mammalian copper transporter Ctr1 in
copper homeostasis and embryonic development. Proc Natl Acad Sci U S A 98(12):6842–6847.
doi:10.1073/pnas.111058698
Levi S, Salfeld J, Franceschinelli F, Cozzi A, Dorner MH, Arosio P (1989) Expression and
structural and functional properties of human ferritin L-chain from Escherichia coli. Biochem-
istry 28(12):5179–5184
Li L, Chen OS, McVey Ward D, Kaplan J (2001) CCC1 is a transporter that mediates vacuolar iron
storage in yeast. J Biol Chem 276(31):29515–29519
Li XL, Zhang HM, Ai Q, Liang G, Yu D (2016) Two bHLH transcription factors, bHLH34 and
bHLH104, regulate iron homeostasis in Arabidopsis thaliana. Plant Physiol. doi:10.1104/pp.
15.01827
Ling HQ, Bauer P, Bereczky Z, Keller B, Ganal M (2002) The tomato fer gene encoding a bHLH
protein controls iron-uptake responses in roots. Proc Natl Acad Sci U S A 99(21):13938–13943
Lobréaux S, Briat JF (1991) Ferritin accumulation and degradation in different organs of pea
(Pisum sativum) during development. Biochem J 274(Pt 2):601–606
Long JC, Merchant SS (2008) Photo-oxidative stress impacts the expression of genes encoding
iron metabolism components in Chlamydomonas. Photochem Photobiol 84(6):1395–1403.
doi:10.1111/j.1751-1097.2008.00451.x
Long JC, Sommer F, Allen MD, Lu SF, Merchant SS (2008) FER1 and FER2 encoding two ferritin
complexes in Chlamydomonas reinhardtii chloroplasts are regulated by iron. Genetics 179
(1):137–147. doi:10.1534/genetics.107.083824
Long TA, Tsukagoshi H, Busch W, Lahner B, Salt DE, Benfey PN (2010) The bHLH transcription
factor POPEYE regulates response to iron deficiency in Arabidopsis roots. Plant Cell 22
(7):2219–2236
MacDiarmid CW, Milanick MA, Eide DJ (2003) Induction of the ZRC1 metal tolerance gene in
zinc-limited yeast confers resistance to zinc shock. J Biol Chem 278(17):15065–15072
Malasarn D, Kropat J, Hsieh SI, Finazzi G, Casero D, Loo JA, Pellegrini M, Wollman FA,
Merchant SS (2013) Zinc deficiency impacts CO2 assimilation and disrupts copper homeosta-
sis in Chlamydomonas reinhardtii. J Biol Chem 288(15):10672–10683. doi:10.1074/jbc.M113.
455105
Martinoia E, Maeshima M, Neuhaus HE (2007) Vacuolar transporters and their essential role in
plant metabolism. J Exp Bot 58(1):83–102. doi:10.1093/jxb/erl183
Martinoia E, Meyer S, De Angeli A, Nagy R (2012) Vacuolar transporters in their physiological
context. Annu Rev Plant Biol 63:183–213. doi:10.1146/annurev-arplant-042811-105608
McKie AT (2008) The role of Dcytb in iron metabolism: an update. Biochem Soc Trans 36
(Pt 6):1239–1241
McKie AT, Barrow D, Latunde-Dada GO, Rolfs A, Sager G, Mudaly E, Mudaly M, Richardson C,
Barlow D, Bomford A, Peters TJ, Raja KB, Shirali S, Hediger MA, Farzaneh F, Simpson RJ
(2001) An iron-regulated ferric reductase associated with the absorption of dietary iron.
Science 291(5509):1755–1759
Meiser J, Lingam S, Bauer P (2011) Posttranslational regulation of the iron deficiency basic helix-
loop-helix transcription factor FIT is affected by iron and nitric oxide. Plant Physiol 157
(4):2154–2166. doi:10.1104/pp.111.183285
Merchant S, Bogorad L (1986a) Rapid degradation of apoplastocyanin in Cu(II)-deficient cells of
Chlamydomonas reinhardtii. J Biol Chem 261(34):15850–15853
Merchant S, Bogorad L (1986b) Regulation by copper of the expression of plastocyanin and
cytochrome c552 in Chlamydomonas reinhardtii. Mol Cell Biol 6(2):462–469
Merchant S, Sawaya MR (2005) The light reactions: a guide to recent acquisitions for the picture
gallery. Plant Cell 17(3):648–663. doi:10.1105/tpc.105.030676
228 E.I. Urzica
Merchant SS, Allen MD, Kropat J, Moseley JL, Long JC, Tottey S, Terauchi AM (2006) Between
a rock and a hard place: trace element nutrition in Chlamydomonas. Biochim Biophys Acta
1763(7):578–594. doi:10.1016/j.bbamcr.2006.04.007
Fritz-Laylin LK, Marechal-Drouard L, Marshall WF, Qu LH, Nelson DR, Sanderfoot AA,
Spalding MH, Kapitonov VV, Ren Q, Ferris P, Lindquist E, Shapiro H, Lucas SM,
Grimwood J, Schmutz J, Cardol P, Cerutti H, Chanfreau G, Chen CL, Cognat V, Croft MT,
Dent R, Dutcher S, Fernandez E, Fukuzawa H, Gonzalez-Ballester D, Gonzalez-Halphen D,
Hallmann A, Hanikenne M, Hippler M, Inwood W, Jabbari K, Kalanon M, Kuras R, Lefebvre
PA, Lemaire SD, Lobanov AV, Lohr M, Manuell A, Meier I, Mets L, Mittag M, Mittelmeier T,
Moroney JV, Moseley J, Napoli C, Nedelcu AM, Niyogi K, Novoselov SV, Paulsen IT,
Pazour G, Purton S, Ral JP, Riano-Pachon DM, Riekhof W, Rymarquis L, Schroda M,
Stern D, Umen J, Willows R, Wilson N, Zimmer SL, Allmer J, Balk J, Bisova K, Chen CJ,
Elias M, Gendler K, Hauser C, Lamb MR, Ledford H, Long JC, Minagawa J, Page MD, Pan J,
Pootakham W, Roje S, Rose A, Stahlberg E, Terauchi AM, Yang P, Ball S, Bowler C,
Dieckmann CL, Gladyshev VN, Green P, Jorgensen R, Mayfield S, Mueller-Roeber B,
Rajamani S, Sayre RT, Brokstein P, Dubchak I, Goodstein D, Hornick L, Huang YW,
Jhaveri J, Luo Y, Martinez D, Ngau WC, Otillar B, Poliakov A, Porter A, Szajkowski L,
Werner G, Zhou K, Grigoriev IV, Rokhsar DS, Grossman AR (2007) The Chlamydomonas
genome reveals the evolution of key animal and plant functions. Science 318(5848):245–250.
doi:10.1126/science.1143609
Morrissey J, Baxter IR, Lee J, Li L, Lahner B, Grotz N, Kaplan J, Salt DE, Guerinot ML (2009)
The ferroportin metal efflux proteins function in iron and cobalt homeostasis in Arabidopsis.
Plant Cell 21(10):3326–3338
Moseley J, Quinn J, Eriksson M, Merchant S (2000) The Crd1 gene encodes a putative di-iron
enzyme required for photosystem I accumulation in copper deficiency and hypoxia in
Chlamydomonas reinhardtii. EMBO J 19(10):2139–2151. doi:10.1093/emboj/19.10.2139
Moseley JL, Allinger T, Herzog S, Hoerth P, Wehinger E, Merchant S, Hippler M (2002a)
21(24):6709–6720
Moseley JL, Page MD, Alder NP, Eriksson M, Quinn J, Soto F, Theg SM, Hippler M, Merchant S
(2002b) Reciprocal expression of two candidate di-iron enzymes affecting photosystem I and
light-harvesting complex accumulation. Plant Cell 14(3):673–688
Muhlenhoff U, Stadler JA, Richhardt N, Seubert A, Eickhorst T, Schweyen RJ, Lill R,
Wiesenberger G (2003) A specific role of the yeast mitochondrial carriers MRS3/4p in
mitochondrial iron acquisition under iron-limiting conditions. J Biol Chem 278
(42):40612–40620. doi:10.1074/jbc.M307847200
Narayanan NN, Ihemere U, Chiu WT, Siritunga D, Rajamani S, Singh S, Oda S, Sayre RT (2011)
The iron assimilatory protein, FEA1, from Chlamydomonas reinhardtii facilitates iron-specific
metal uptake in yeast and plants. Front Plant Sci 2:67. doi:10.3389/fpls.2011.00067
Naumann B, Stauber EJ, Busch A, Sommer F, Hippler M (2005) N-terminal processing of
Lhca3 Is a key step in remodeling of the photosystem I-light-harvesting complex under iron
deficiency in Chlamydomonas reinhardtii. J Biol Chem 280(21):20431–20441. doi:10.1074/
jbc.M414486200
Naumann B, Busch A, Allmer J, Ostendorf E, Zeller M, Kirchhoff H, Hippler M (2007) Compar-
ative quantitative proteomics to investigate the remodeling of bioenergetic pathways under
iron deficiency in Chlamydomonas reinhardtii. Proteomics 7(21):3964–3979. doi:10.1002/
pmic.200700407
Nevo Y, Nelson N (2006) The NRAMP family of metal-ion transporters. Biochim Biophys Acta
1763(7):609–620
Njus D, Kelley PM, Harnadek GJ, Pacquing YV (1987) Mechanism of ascorbic acid regeneration
mediated by cytochrome b561. Ann N Y Acad Sci 493:108–119
Ogo Y, Itai RN, Nakanishi H, Inoue H, Kobayashi T, Suzuki M, Takahashi M, Mori S,

Nishizawa NK (2006) Isolation and characterization of IRO2, a novel iron-regulated
bHLH transcription factor in graminaceous plants. J Exp Bot 57(11):2867–2878
Page MD, Kropat J, Hamel PP, Merchant SS (2009) Two Chlamydomonas CTR copper trans-
porters with a novel cys-met motif are localized to the plasma membrane and function in
copper assimilation. Plant Cell 21(3):928–943. doi:10.1105/tpc.108.064907
Page MD, Allen MD, Kropat J, Urzica EI, Karpowicz SJ, Hsieh SI, Loo JA, Merchant SS (2012)
Fe sparing and Fe recycling contribute to increased superoxide dismutase capacity in iron-
starved Chlamydomonas reinhardtii. Plant Cell 24(6):2649–2665. doi:10.1105/tpc.112.098962
Penarrubia L, Andres-Colas N, Moreno J, Puig S (2010) Regulation of copper transport in
Arabidopsis thaliana: a biochemical oscillator? J Biol Inorg Chem 15(1):29–36. doi:10.1007/
s00775-009-0591-8
Petit JM, Briat JF, Lobreaux S (2001) Structure and differential expression of the four members of
the Arabidopsis thaliana ferritin gene family. Biochem J 359(Pt 3):575–582
Philpott CC (2006) Iron uptake in fungi: a system for every source. Biochim Biophys Acta 1763
(7):636–645
Pilon M, Abdel-Ghany SE, Cohu CM, Gogolin KA, Ye H (2006) Copper cofactor delivery in plant
cells. Curr Opin Plant Biol 9(3):256–263. doi:10.1016/j.pbi.2006.03.007
Portnoy ME, Liu XF, Culotta VC (2000) Saccharomyces cerevisiae expresses three functionally
distinct homologues of the Nramp family of metal transporters. Mol Cell Biol 20
(21):7893–7902
Puig S, Andres-Colas N, Garcia-Molina A, Penarrubia L (2007) Copper and iron homeostasis in
Arabidopsis: responses to metal deficiencies, interactions and biotechnological applications.
Plant Cell Environ 30(3):271–290. doi:10.1111/j.1365-3040.2007.01642.x
Quinn JM, Merchant S (1995) Two copper-responsive elements associated with the
Chlamydomonas Cyc6 gene function as targets for transcriptional activators. Plant Cell 7
(5):623–628. doi:10.1105/tpc.7.5.623
Quinn JM, Barraco P, Eriksson M, Merchant S (2000) Coordinate copper- and oxygen-responsive
Cyc6 and Cpx1 expression in Chlamydomonas is mediated by the same element. J Biol Chem
275(9):6080–6089
Quinn JM, Eriksson M, Moseley JL, Merchant S (2002) Oxygen deficiency responsive gene
expression in Chlamydomonas reinhardtii through a copper-sensing signal transduction path-
way. Plant Physiol 128(2):463–471. doi:10.1104/pp.010694
Rees EM, Lee J, Thiele DJ (2004) Mobilization of intracellular copper stores by the Ctr2 vacuolar
copper transporter. J Biol Chem 279(52):54221–54229
Riedel HD, Remus AJ, Fitscher BA, Stremmel W (1995) Characterization and partial purification
of a ferrireductase from human duodenal microvillus membranes. Biochem J 309
(Pt 3):745–748
Ruiz FA, Marchesini N, Seufferheld M, Govindjee, Docampo R (2001) The polyphosphate bodies
of Chlamydomonas reinhardtii possess a proton-pumping pyrophosphatase and are similar to
acidocalcisomes. J Biol Chem 276(49):46196–46203
Salahudeen AA, Thompson JW, Ruiz JC, Ma HW, Kinch LN, Li Q, Grishin NV, Bruick RK
(2009) An E3 ligase possessing an iron-responsive hemerythrin domain is a regulator of iron
homeostasis. Science 326(5953):722–726
Sancenon V, Puig S, Mira H, Thiele DJ, Penarrubia L (2003) Identification of a copper transporter
family in Arabidopsis thaliana. Plant Mol Biol 51(4):577–587
Santi S, Schmidt W (2009) Dissecting iron deficiency-induced proton extrusion in Arabidopsis
roots. New Phytol 183(4):1072–1084. doi:10.1111/j.1469-8137.2009.02908.x
Sanvisens N, Bano MC, Huang M, Puig S (2011) Regulation of ribonucleotide reductase in
response to iron deficiency. Mol Cell 44(5):759–769. doi:10.1016/j.molcel.2011.09.021
Schaaf G, Honsbein A, Meda AR, Kirchner S, Wipf D, von Wirén N (2006) AtIREG2 encodes a
tonoplast transport protein involved in iron-dependent nickel detoxification in Arabidopsis
thaliana roots. J Biol Chem 281(35):25532–25540
230 E.I. Urzica
Selote D, Samira R, Matthiadis A, Gillikin JW, Long TA (2015) Iron-binding E3 ligase mediates
iron response in plants by targeting basic helix-loop-helix transcription factors. Plant Physiol
167(1):273–286. doi:10.1104/pp.114.250837
Shaw GC, Cope JJ, Li L, Corson K, Hersey C, Ackermann GE, Gwynn B, Lambert AJ, Wingert RA,
Traver D, Trede NS, Barut BA, Zhou Y, Minet E, Donovan A, Brownlie A, Balzan R, Weiss MJ,
Peters LL, Kaplan J, Zon LI, Paw BH (2006) Mitoferrin is essential for erythroid iron assim-
ilation. Nature 440(7080):96–100. doi:10.1038/nature04512
Shen J, Xu X, Li T, Cao D, Han Z (2008) An MYB transcription factor from Malus xiaojinensis
has a potential role in iron nutrition. J Integr Plant Biol 50(10):1300–1306
Shikanai T, Muller-Moule P, Munekage Y, Niyogi KK, Pilon M (2003) PAA1, a P-type ATPase of
Arabidopsis, functions in copper transport in chloroplasts. Plant Cell 15(6):1333–1346
Sinclair SA, Kramer U (2012) The zinc homeostasis network of land plants. Biochim Biophys
Acta 1823(9):1553–1567. doi:10.1016/j.bbamcr.2012.05.016
Singh A, Kaur N, Kosman DJ (2007) The metalloreductase Fre6p in Fe-efflux from the yeast
vacuole. J Biol Chem 282(39):28619–28626
Strozycki PM, Szymanski M, Szczurek A, Barciszewski J, Figlerowicz M (2010) A new family of
ferritin genes from Lupinus luteus – comparative analysis of plant ferritins, their gene struc-
ture, and evolution. Mol Biol Evol 27(1):91–101. doi:10.1093/molbev/msp196
Su D, Asard H (2006) Three mammalian cytochromes b561 are ascorbate-dependent ferrireductases.
FEBS J 273(16):3722–3734
Takeuchi F, Hori H, Obayashi E, Shiro Y, Tsubaki M (2004) Properties of two distinct heme
centers of cytochrome b561 from bovine chromaffin vesicles studied by EPR, resonance
Raman, and ascorbate reduction assay. J Biochem 135(1):53–64
Terauchi AM, Peers G, Kobayashi MC, Niyogi KK, Merchant SS (2010) Trophic status of
Chlamydomonas reinhardtii influences the impact of iron deficiency on photosynthesis.
Photosynth Res 105(1):39–49. doi:10.1007/s11120-010-9562-8
Terzulli AJ, Kosman DJ (2009) The Fox1 ferroxidase of Chlamydomonas reinhardtii: a new
multicopper oxidase structural paradigm. J Biol Inorg Chem 14(2):315–325. doi:10.1007/
s00775-008-0450-z
Terzulli A, Kosman DJ (2010) Analysis of the high-affinity iron uptake system at the
Chlamydomonas reinhardtii plasma membrane. Eukaryot Cell 9(5):815–826. doi:10.1128/
EC.00310-09
Theil EC (1987) Ferritin: structure, gene regulation, and cellular function in animals, plants and
microorganisms. Annu Rev Biochem 56:289–315
Thomine S, Vert G (2013) Iron transport in plants: better be safe than sorry. Curr Opin Plant Biol
16(3):322–327. doi:10.1016/j.pbi.2013.01.003
Thomine S, Wang R, Ward JM, Crawford NM, Schroeder JI (2000) Cadmium and iron transport
by members of a plant metal transporter family in Arabidopsis with homology to Nramp genes.
Proc Natl Acad Sci U S A 97(9):4991–4996
Tottey S, Block MA, Allen M, Westergren T, Albrieux C, Scheller HV, Merchant S, Jensen PE (2003)
Arabidopsis CHL27, located in both envelope and thylakoid membranes, is required for the
synthesis of protochlorophyllide. Proc Natl Acad Sci U S A 100(26):16119–16124. doi:10.1073/
pnas.2136793100
Trost P, Bèrczi A, Sparla F, Sponza G, Marzadori B, Asard H, Pupillo P (2000) Purification of
cytochrome b561 from bean hypocotyls plasma membrane. Evidence for the presence of two
heme centers. Biochim Biophys Acta 1468(1–2):1–5
Urzica EI, Casero D, Yamasaki H, Hsieh SI, Adler LN, Karpowicz SJ, Blaby-Haas CE, Clarke
SG, Loo JA, Pellegrini M, Merchant SS (2012) Systems and trans-system level analysis
identifies conserved iron deficiency responses in the plant lineage. Plant Cell 24
(10):3921–3948. doi:10.1105/tpc.112.102491
Van Wuytswinkel O, Vansuyt G, Grignon N, Fourcroy P, Briat JF (1998) Iron homeostasis
alteration in transgenic tobacco overexpressing ferritin. Plant J 17(1):93–97
Vargas JD, Herpers B, McKie AT, Gledhill S, McDonnell J, van den Heuvel M, Davies KE,
Ponting CP (2003) Stromal cell-derived receptor 2 and cytochrome b561 are functional ferric
reductases. Biochim Biophys Acta 1651(1-2):116–123
Vashisht AA, Zumbrennen KB, Huang X, Powers DN, Durazo A, Sun D, Bhaskaran N, Persson A,
Uhlen M, Sangfelt O, Spruck C, Leibold EA, Wohlschlegel JA (2009) Control of iron
homeostasis by an iron-regulated ubiquitin ligase. Science 326(5953):718–721
Wade VJ, Treffry A, Laulhere JP, Bauminger ER, Cleton MI, Mann S, Briat JF, Harrison PM
(1993) Structure and composition of ferritin cores from pea seed (Pisum sativum). Biochim
Biophys Acta 1161(1):91–96
Walker EL, Connolly EL (2008) Time to pump iron: iron-deficiency-signaling mechanisms of
higher plants. Curr Opin Plant Biol 11(5):530–535. doi:10.1016/j.pbi.2008.06.013
Williams RJP (2001) Chemical selection of elements by cells. Coord Chem Rev 216–217:583–595.
doi:10.1016/S0010-8545(00)00398-2
Yagisawa F, Nishida K, Yoshida M, Ohnuma M, Shimada T, Fujiwara T, Yoshida Y, Misumi O,
Kuroiwa H, Kuroiwa T (2009) Identification of novel proteins in isolated polyphosphate
vacuoles in the primitive red alga Cyanidioschyzon merolae. Plant J 60(5):882–893
Yamasaki H, Hayashi M, Fukazawa M, Kobayashi Y, Shikanai T (2009) SQUAMOSA promoter
binding protein-like7 is a central regulator for copper homeostasis in Arabidopsis. Plant Cell 21
(1):347–361. doi:10.1105/tpc.108.060137
Yuan YX, Zhang J, Wang DW, Ling HQ (2005) AtbHLH29 of Arabidopsis thaliana is a functional
ortholog of tomato FER involved in controlling iron acquisition in strategy I plants. Cell Res 15
(8):613–621
Zancani M, Peresson C, Biroccio A, Federici G, Urbani A, Murgia I, Soave C, Micali F,
Vianello A, Macri F (2004) Evidence for the presence of ferritin in plant mitochondria. Eur J
Biochem 271(18):3657–3664. doi:10.1111/j.1432-1033.2004.04300.x
Zhang DL, Su D, Bérczi A, Vargas A, Asard H (2006) An ascorbate-reducible cytochrome b561 is
localized in macrophage lysosomes. Biochim Biophys Acta 1760(12):1903–1913
Zhang J, Liu B, Li M, Feng D, Jin H, Wang P, Liu J, Xiong F, Wang J, Wang HB (2015) The
bHLH transcription factor bHLH104 interacts with IAA-LEUCINE RESISTANT3 and mod-
ulates iron homeostasis in Arabidopsis. Plant Cell 27(3):787–805. doi:10.1105/tpc.114.132704
Zheng L, Huang F, Narsai R, Wu J, Giraud E, He F, Cheng L, Wang F, Wu P, Whelan J, Shou H
(2009) Physiological and transcriptome analysis of iron and phosphorus interaction in rice
seedlings. Plant Physiol 151(1):262–274
Calcium-Dependent Signalling Processes
in Chlamydomonas
Glen L. Wheeler
Abstract Like all organisms, the motile green alga Chlamydomonas has evolved
an array of sensory mechanisms to enable it to detect and respond to an array of
abiotic and biotic stimuli. It is clear that Ca2+-dependent signalling mechanisms are
central to many responses in Chlamydomonas, from flagella function through to
stress signalling and photosynthesis. Chlamydomonas has long been used as a
model organism for flagella function and this aspect of signalling has received
much attention, with well-characterised roles for Ca2+ in flagella beat, phototaxis,
mating and deflagellation. Recent progress has identified a series of ion channels
and Ca2+-sensor kinases that underpin these responses and direct imaging of
flagella Ca2+ in Chlamydomonas cells has demonstrated the highly dynamic nature
of Ca2+ signalling in these organelles. The role of Ca2+ in other signalling processes
in Chlamydomonas has been less well explored, although exciting recent develop-
ments have demonstrated novel Ca2+-dependent signalling processes associated
with the regulation of photosynthesis. These developments highlight the diverse
roles of Ca2+ in Chlamydomonas physiology and the potential for the discovery of
novel Ca2+ signalling mechanisms within this organism.
1 Introduction
All organisms must sense and respond to their environment to ensure their survival.
As a motile soil-dwelling photosynthetic green alga, Chlamydomonas is likely to
experience rapid changes in light, osmotic stress and nutrient availability and
possesses diverse signalling mechanisms to help the cell respond to these stimuli.
In eukaryotes, Ca2+ acts a versatile second messenger, amplifying and propagating
intracellular signals in response to diverse environmental stimuli. Eukaryote cells
maintain a very low cytosolic concentration of Ca2+ (100 nM), resulting in a large
inward concentration gradient. The activation of Ca2+-permeable channels
localised to the plasma membrane or internal membranes results in rapid Ca2+
influx, leading to elevations in cytosolic Ca2+ ([Ca2+]cyt). Ca2+ efflux proteins such
G.L. Wheeler (*)

Marine Biological Association, The Laboratory, Citadel Hill, Plymouth PL1 2PB, UK

234 G.L. Wheeler
as Ca2+ ATPases or Ca2+/H+ exchangers return [Ca2+]cyt to its resting level and
therefore play an important role in shaping the Ca2+ transient (McAinsh
and Pittman 2009). Diverse Ca2+-binding proteins, such as calmodulin (CaM), the
calcium-dependent protein kinases (CDPKs) or the calcineurin B-like (CBL)
calcium sensor proteins and their CBL-interacting protein kinases (CIPKs), respond
to the changes in cytosolic Ca2+ by eliciting a host of downstream responses (Edel
and Kudla 2015; Zhu et al. 2015). As [Ca2+]cyt elevations are generated by a wide
variety of stimuli, specificity in Ca2+ signalling is conveyed by the spatial and
temporal dynamics of each [Ca2+]cyt elevation. For example, [Ca2+]cyt elevations
can take the form of brief localised spikes lasting <1 s or large whole cell [Ca2+]cyt
elevations that persist for minutes or even hours. In combination with the broad
range of downstream responders, the distinct spatiotemporal dynamics of [Ca2+]cyt
elevations enable the cell to use Ca2+ signalling in response to many different
stimuli. Ca2+ has been implicated in many different signalling processes in
Chlamydomonas. Many of these relate to flagella function, reflecting the extensive
use of Chlamydomonas as a model organism for the study of this organelle, but
emerging evidence suggests that Ca2+ plays a central role in many other cellular
processes. This review aims to highlight the different roles of Ca2+ within the cell
and identify some of the key recent developments that are now providing insight
into the underlying cellular mechanisms.
2 Ca2+ Signalling in Flagella Motility
2.1 Ca2+-Sensitive Elements Involved in Flagellar Beat
Ca2+ signalling plays a central role in regulating swimming motility in

Chlamydomonas, and this aspect of signalling is the most extensively characterised
in this alga. Research into flagellar signalling mechanisms has had a significant
wider impact, exemplified by the discovery of the novel light-gated ion channel
channelrhodopsin. Chlamydomonas has two flagella that beat at 50–70 Hz in a
breaststroke motion. This results in a helical swimming path, in which the cell
moves forwards at a velocity of 100–200 μm s1, whilst the cell body rotates about
its longitudinal axis at 2 Hz. Swimming Chlamydomonas cells exhibit two very
characteristic responses to light, photoshock and phototaxis. In the photoshock
response, sudden exposure to high light results in a rapid but transient (duration
500 ms) switch to an undulating flagellar waveform, resulting in a brief period of
backwards swimming (Fig. 1). In the phototactic response, differential activation of
the cis (closest to eyespot)- and trans (furthest from eyespot)-flagella enables a
change in swimming direction towards or away from a directional light source.
Experiments using demembranated cell models (cells permeabilised with a
non-ionic detergent) demonstrated that Ca2+ plays a direct role in controlling the
beat frequency and waveform of the flagella. Changing Ca2+ in the medium from
Calcium-Dependent Signalling Processes in Chlamydomonas 235
CAV2
CAV2
LC4 LC4
Trp11
Mechanical
stimuli
ChR1
Bright
light
Mechanoshock Photoshock
Fig. 1 Cellular mechanisms underlying the phobic motile responses. The scheme illustrates the
major proteins identified in phobic swimming responses of Chlamydomonas cells. In the
mechanoshock response, the flagella-localised mechanosensitive ion channel TRP11 is proposed
to activate the voltage-gated Ca2+ channel CAV2. In the photoshock response, bright light
activates channelrhodopsin (ChR1), leading to a whole cell depolarisation and activation of
CAV2 in the flagella membrane. In both responses, the resultant intraflagellar Ca2+ elevations
are likely sensed by LC4 in the outer dynein arm, which causes the switch to the undulating
waveform and the onset of backwards swimming
<106 M to 104 M resulted in a shift from the breaststroke waveform of cell

models to the undulating waveform observed during photoshock (Bessen et al. 1980;
Hyams and Borisy 1978). Smaller changes in Ca2+ were observed to modulate the
breaststroke waveform differently between the two flagella. The cis-flagellum beats
strongest at low Ca2+ (<107 M), whereas the trans-flagellum beats strongest at
higher Ca2+ concentrations (Kamiya and Witman 1984). These findings indicated
that phototaxis, as well as the photoshock response, is directly mediated by changes
in intraflagellar Ca2+. In support of this, a mutant strain was isolated (ptx1) which
lacks the Ca2+-dependent shift in flagellar dominance and shows very little photo-
tactic ability (Horst and Witman 1993; Okita et al. 2005).
Ca2+ modulates the flagellar beat patterns by binding directly to a range of
axonemal proteins, although the modes of regulation are likely to be complex. Of
the 650 proteins that are known to comprise the flagella axoneme in
Chlamydomonas, 27 are predicted to bind Ca2+ (DiPetrillo and Smith 2013; Pazour
et al. 2005). Flagellar beat is driven by the axonemal dyneins, which are arranged in
the inner and outer dynein arms. Outer dynein arm mutants exhibit a defective
photoshock response, with little or no backwards swimming (Kamiya and Okamoto
1985). Two Ca2+-binding proteins have been characterised in the outer dynein arm,
LC4 and DC3. The docking complex protein DC3 has two consensus EF hands and
236 G.L. Wheeler
oda14 mutants, which lack DC3 and show defects in the photoshock response
(Casey et al. 2003a). However, this phenotype is most likely due to defects in
outer arm assembly in oda14 rather than Ca2+ binding by DC3, as complementation
of oda14 with a modified DC3 protein that does not bind Ca2+ restored the assembly
of the outer dynein arms and the photoshock response (Casey et al. 2003b). LC4 is
also related to calmodulin and undergoes a conformational change on binding Ca2+.
The affinity of LC4 for Ca2+ and its interactions with other outer dynein arm
proteins makes it the prime candidate to act as the major Ca2+ sensor in the outer
dynein arm and mediate the waveform conversion observed during the photoshock
response (Sakato et al. 2007).
Calmodulin (CaM) also plays an important role in modifying flagellar beat, by
regulating dynein-driven microtubule sliding through interactions with the central
pair of microtubules and the radial spokes (Smith 2002). CaM-containing com-
plexes associated with either the radial spokes or the central pair have been purified
from Chlamydomonas flagella, indicating the CaM acts in multiple roles (Dymek
and Smith 2007; Patel-King et al. 2004). A further CaM-containing complex was
isolated in high Ca2+ buffer, suggesting that changes in intraflagellar Ca2+ cause
CaM to form additional regulatory complexes (DiPetrillo and Smith 2010, 2013).
2.2 Light-Dependent Signalling Pathways
The photoshock and phototactic responses are both mediated by channelrhodopsin,

a light-gated ion channel localised to the plasma membrane adjacent to the eyespot.
The eyespot is composed of a series of carotenoid-rich lipid globules in the
chloroplast and is positioned approximately half way along the longitudinal axis
of the cell. The eyespot acts as a quarter-wave stack antenna, reflecting light
onto the plasma membrane adjacent to the eyespot where the receptor
(channelrhodopsin) is situated (Foster and Smyth 1980). Electrophysiological
approaches have enabled the extensive characterisation of the light-dependent ion
currents in Chlamydomonas. A flash of light results in an initial inward current (the
photocurrent, PC or Ip) in the region of the eyespot. The photocurrent rises with
virtually no delay at saturating light intensities and was initially shown to be carried
largely by Ca2+ (Harz and Hegemann 1991; Holland et al. 1996). However, when
the driving force is sufficiently large, H+, Na+ and K+ can also contribute signifi-
cantly to the photocurrent (Ehlenbeck et al. 2002; Holland et al. 1996;
Nonnengasser et al. 1996). The lack of a delay in the rise of the photocurrent
(<500 μs) suggested that the light receptor and the ion channel were either very
tightly linked or represented the same protein. The discovery of two genes (ChR1
and ChR2) encoding a novel light-gated ion channel (channelrhodopsin) demon-
strated that the latter hypothesis was correct. When expressed in Xenopus oocytes,
both ChR1 and ChR2 elicit large light-dependent H+ conductances (Nagel et al.
2002, 2003). However, unlike the voltage-gated H+ channels that exhibit a near-
perfect selectivity for H+ (DeCoursey 2013), channelrhodopsins are much less
selective for H+ (Berthold et al. 2008; Schneider et al. 2013). As the relative
external concentrations of other cations is often much greater than that of H+,
particularly at alkaline pH, the photocurrent may be carried by Ca2+, Na+ or K+
even though channelrhodopsins exhibit a greater permeability for H+ (Berthold
et al. 2008). The discovery and subsequent optogenetic application of
channelrhodopsin have revolutionised the study of neuroscience, by enabling
non-invasive activation of transgenic neurons expressing channelrhodopsins.
Studies using anti-sense knockdown of channelrhodopsins suggested that ChR1
and ChR2 may perform different roles within the cell, with ChR1 responsible
primarily for responses to high light, e.g. photoshock, and ChR2 responsible for
low-light responses such as phototaxis (Sineshchekov et al. 2002). However, a more
recent study using gametes of cw2, which exhibit very little ChR2 expression,
demonstrated that RNAi knockdown of ChR1 almost completely prevented the
photocurrent and strongly inhibited the photoshock and the phototactic responses
(Berthold et al. 2008). This suggests that ChR1 alone can contribute to both of these
processes. The requirement for two functional channelrhodopsins in
Chlamydomonas therefore remains unclear.
The intensity of the light stimulus determines the amplitude of the photocurrent,
which causes depolarisation of the membrane potential. If the extent of
depolarisation reaches a certain threshold, voltage-gated Ca2+ channels in the
flagella membrane are activated, leading to Ca2+ influx into the flagella (Harz and
Hegemann 1991). The flagella current is carried by Ca2+ and has two clear
components: a fast transient current (IFF) lasting a few ms that coincides with the
switch to the undulating waveform and a slower sustained flagella current (IFS) that
has a much smaller amplitude and lasts around 600 ms, similar to the duration of the
backwards swimming (Holland et al. 1997). The fast flagella current represents an
action potential, as it is an all-or-nothing response that is triggered when a threshold
depolarisation is reached. In the presence of 100 μM Ba2+, the slow flagella current
has a much larger amplitude and leads to a sustained and erratic photophobic
response (Holland et al. 1996). This suggests that the slow flagella current is
normally regulated by feedback inhibition from the intraflagellar Ca2+ concentra-
tion, allowing maintenance of a similar intraflagellar Ca2+ concentration throughout
the duration of the photophobic response (Holland et al. 1996). Characterisation of
a mutant, ppr2, which is defective in the photophobic response but not in photo-
taxis, revealed that this phenotype was due to a defect in CAV2, a homologue of the
mammalian four-domain voltage-gated Ca2+ channels (Fujiu et al. 2009). CAV2
localises to the distal region of the flagella and appears to play a major role in
mediating the flagellar Ca2+ influx during the photophobic response.
The electrophysiological characterisation of the photoshock response not only
provides important information on the molecular mechanisms of Ca2+ signalling in
Chlamydomonas but also demonstrates an important environmental aspect of this
signalling mechanism. The imperfect H+ selectivity of ChR1 and ChR2 allows the
photocurrent to be carried by other cations, such as Na+ or Ca2+ at alkaline pH
environments where the concentration of H+ is much lower. The feedback inactiva-
tion of the resultant flagella current by the intraflagellar Ca2+ concentration ensures
238 G.L. Wheeler
that the flagella response is very similar even in a wide range of external Ca2+
concentrations. Thus, even if the cell encounters aquatic environments with a
significantly different ionic composition, which is highly likely for a freshwater/
soil organism, the cell is able to generate a robust and reproducible photoshock
response.
Whilst it is clear that the photoshock response is mediated by light-induced
depolarisation of the plasma membrane, the mechanism through which
channelrhodopsin directs phototaxis is less clear. Channelrhodopsin is clearly the
sensor for phototaxis, as demonstrated by RNAi knockdown of ChR1 (Berthold
et al. 2008). However, phototaxis can be observed at low light intensities where the
photocurrent is only sufficient to depolarise the cellular membrane potential by
1 mV, which elicits no measurable flagella current (Hegemann and Berthold 2009).
The ppr2 mutant, which lacks the flagella-localised voltage-gated Ca2+ channel
CAV2, exhibits normal phototaxis (Matsuda et al. 1998). These findings suggest
that phototaxis does not rely on changes in flagella membrane potential and that
additional signalling mechanisms are required in order to transmit information from
the sensory region (the eyespot) to the flagella.
2.3 Other Motile Responses
Chlamydomonas exhibits a mechanoshock response, where the flagella briefly

switch to an undulating waveform on encountering a solid surface, causing a
brief period (<1 s) of backwards swimming. The swimming response during
mechanoshock is similar to that of photoshock, although clearly the sensory
mechanisms are different. In addition to the mechanoshock response,
Chlamydomonas also exhibits a Ca2+-dependent increase in swimming velocity
following a mechanical stimulus, such as shear stress induced by vortexing a
population of swimming cells (Wakabayashi et al. 2009). By applying suction to
flagella using a micropipette, Yoshimura (1996) demonstrated that
Chlamydomonas flagella are directly mechanosensitive. Suction induced a series
of repetitive inward Ca2+ currents in flagella that were sensitive to Gd3+ and Ba2+
(Yoshimura 1996). Chlamydomonas flagella possess a number of candidate
mechanosensitive ion channels, most notably a range of transient receptor potential
(TRP) channels, which are known to play a role in mechanosensation in animal
cells (Huang et al. 2007). A study of the localisation of a range of TRP channels
indicated that TRP11 was localised exclusively to the flagella with the greatest
abundance at the proximal region (Fujiu et al. 2011). RNAi-mediated knockdown
of TRP11 expression resulted in a greatly reduced mechanoshock response (Fujiu
et al. 2011). The mechanoshock response is absent in the ppr2 mutant, suggesting
that activation of TRP11 by mechanical stimulation leads to a depolarisation of the
flagella membrane and activation of CAV2 (Fujiu et al. 2009). Mechanoshock
responses have been characterised in other motile green algae such as
Spermatozopsis, although in this case the alga responds by a very rapid acceleration
in swimming velocity (Kreimer and Witman 1994). Patch clamp recordings using
reconstituted liposomes from Spermatozopsis flagella membranes indicated the
presence of a voltage-gated Ca2+ channel that most likely underlies the avoidance
response (Hill et al. 2000).
Chlamydomonas also demonstrates tactic responses to stimuli other than light.
Vegetative cells exhibit chemotaxis towards ammonium and sugars (Ermilova et al.
1998; Sjoblad and Frederikse 1981), and gametes also exhibit chemotactic responses
to peptone and tryptone (Govorunova and Sineshchekov 2003, 2005). Chemotaxis
towards ammonium is dependent on external Ca2+, and chemotactic responses
towards sugars can be blocked by Ca2+ channel blockers (Ermilova et al. 1998;
Sjoblad and Frederikse 1981). There is some evidence for integration between the
chemotaxis and phototaxis signalling pathways, as the addition of tryptone to
gametes temporarily inhibits the channelrhodopsin-mediated photocurrent
(Govorunova and Sineshchekov 2003). Chlamydomonas also demonstrates negative
gravitaxis, i.e. a tendency to swim upwards, in the absence of light and other stimuli.
Gravitaxis was found to be normal in the ptx1 mutant and was unaffected by the
removal of Ca2+, suggesting that gravitaxis does not involve Ca2+-dependent
signalling mechanisms (Kam et al. 1999; Yoshimura et al. 2003).
3 Other Ca2+ Signalling Processes Related to Flagella

Function
3.1 Mating
Signal transduction during fertilisation has been extensively explored in

Chlamydomonas. The signalling pathway is initiated by contact between agglutinins
on the flagella of gametes of opposite mating types. This results in a signalling
cascade that leads to activation of an adenylyl cyclase and a rise of cyclic AMP
(cAMP) (Wang and Snell 2003). The accumulation of cAMP results in shedding of
the cell walls and activation of mating structures, followed by cell fusion and
formation of the quadriflagellate cell. The elevation of cAMP is central to this
signalling pathway, as mating responses can be induced in gametes by the applica-
tion of cell-permeable cAMP analogue, dibutyryl cAMP, in the presence of the
phosphodiesterase inhibitor IBMX (Brownlee 1994; Pan and Snell 2000). The role
of Ca2+ signalling during mating is less clear. Inhibition of Ca2+ signalling with CaM
antagonists (trifluoperazine and W-7) or Ca2+ channel blockers (e.g. La3+ or Cd2+)
had no effect on flagella agglutination but prevented the rise in cAMP and inhibited
mating (Goodenough et al. 1993; Pasquale and Goodenough 1987). Mating could be
rescued by the addition db-cAMP þ IBMX, suggesting that Ca2+ acts upstream of
the activation of adenylyl cyclase. Mating efficiency is reduced but not completely
inhibited in the absence of external Ca2+, suggesting that a Ca2+ influx across the
plasma membrane and/or the flagella membrane contributes to the signalling
240 G.L. Wheeler
pathway (Goodenough et al. 1993). In combination, these results suggest that

flagella agglutination may trigger a flagellar Ca2+ elevation, which could contribute
to the activation of adenylyl cyclase and the rise in cAMP. Support for this hypoth-
esis came from the characterisation of PKD2 in Chlamydomonas, a homologue of a
mammalian Ca2+-permeable TRP channel. PKD2 is highly expressed in the flagella
of gametes, and RNAi-mediated knockdown of PKD2 resulted in an inhibition of
mating (Huang et al. 2007). The mating defect could be rescued by the addition of
db-cAMP and papaverine (a phosphodiesterase inhibitor), suggesting that PKD2
acts upstream of the adenylyl cyclase and may therefore contribute to flagellar Ca2+
signalling following flagella adhesion (Huang et al. 2007).
3.2 Gliding
In addition to swimming, Chlamydomonas flagella can also support an alternative

form of cellular motility. The flagella membrane of Chlamydomonas contains an
abundant glycoprotein (FMG-1B), which enables the flagella to adhere to a solid
substrate (Bloodgood 1981; Bloodgood and Workman 1984). The regulated move-
ment of FMG-1B in the flagella membrane allows the adherent flagella pull the cell
body forwards and results in the two flagella becoming orientated at 180 to each
other. The movement of FMG-1B in the flagella membrane can also be observed
using microspheres (Bloodgood 1995; Shih et al. 2013). Microspheres move along
the flagellum at a rate similar to gliding motility but this movement differs in that
the beads move back and forth, whereas gliding flagella only move forwards
(Bloodgood 1981). Adhesion of FMG-1B to a solid substrate, such as a microsphere
or a glass surface during gliding motility, results in cross-linking of the flagellar
glycoprotein. Bead movement and gliding motility require the presence of micro-
molar free Ca2+ in the medium, suggesting that the movement of FMG-1B in the
flagella membrane is directly regulated by Ca2+ (Bloodgood 1995; Bloodgood and
Salomonsky 1990).
As the flagella of gliding cells are arranged at 180 and pull the cell body in
opposite directions, there is clearly a need to coordinate the motive force generated
by each flagellum. Direct imaging of intraflagellar Ca2+ ([Ca2+]fla) indicated that no
[Ca2+]fla elevations were observed in the leading flagellum during gliding motility
but a [Ca2+]fla elevation was consistently observed in the trailing flagellum at the
onset of dragging motion (Fig. 2) (Collingridge et al. 2013). This was puzzling as it
had been previously assumed that Ca2+ signalling was linked to the initiation of
force generation by the microtubule motor proteins in the leading flagellum
(Bloodgood 2009). However, this discrepancy was resolved by the discovery that
the retrograde IFT motor cytoplasmic dynein provides the motive force for gliding
motility (Collingridge et al. 2013; Shih et al. 2013). Direct observation of fluores-
cently tagged IFT particles during gliding motility demonstrated that retrograde IFT
particles accumulate in the leading flagellum and are able to drive the flagellum
forward, presumably through a direct interaction with FMG-1B (Collingridge et al.
i.
ii.
trailing leading
iii.
Fig. 2 Flagellar Ca2+ signalling during gliding. Chlamydomonas cells adhere to solid substrates
via their flagella and glide along the surface due to the movement of adherent flagella membrane
glycoproteins. (i) Retrograde IFT particles accumulate in adherent flagella and provide the motive
force to pull the cell body forwards. (ii) As the leading flagellum begins to move forwards, a
intraflagellar Ca2+ elevation occurs in the trailing flagellum only, which disrupts the interaction
between the IFT particles and the flagella membrane in the trailing flagellum. (iii) This prevents a
futile tug-of-war between the two flagella and allows the leading flagellum to pull the cell body
forwards
2013; Shih et al. 2013). In the trailing flagellum, the [Ca2+]fla elevations caused by
the dragging motion disrupt the accumulated retrograde IFT particles, which are
returned to the cell body by retrograde IFT (Collingridge et al. 2013). This suggests
that the interaction between the retrograde IFT particle and FMG-1B is sensitive to
Ca2+. The absence of external Ca2+ inhibits [Ca2+]fla elevations and leads to a
massive accumulation of IFT particles in the regions of the flagellum that are in
contact with the solid surface (Collingridge et al. 2013). In contrast, Shih et al.
(2013) demonstrated that IFT trains pause less frequently in the absence of external
242 G.L. Wheeler
Ca2+ and proposed that Ca2+ was required to initiate the interaction between the IFT
particle and FMG-1B. However, this proposal seems at odds with the direct
observations of [Ca2+]fla and IFT.
The ability to directly observe [Ca2+]fla in Chlamydomonas has highlighted some
important properties relating to these signalling pathways. Firstly, [Ca2+]fla eleva-
tions are very rapid (often <1 s) and they occur simultaneously along the length of
the flagellum, suggesting that changes in membrane potential and activation of
voltage-gated Ca2+ channels are likely to be involved in their generation. Secondly,
the two flagella are able to act as independent Ca2+ signalling entities, which is
essential for the coordination of gliding motility. Thirdly, [Ca2+]fla elevations are
directly linked to the movement of microtubule motor proteins, which has interest-
ing parallels with other cellular processes, such as the Ca2+-dependent movement of
mitochondria along microtubules (Saotome et al. 2008). Although the molecular
identity of the Ca2+ channels involved in the flagellar signalling pathway has not yet
been confirmed, it is likely that the dragging motion of the trailing flagellum is
sensed initially by a mechanosensitive ion channel, which leads to membrane
depolarisation and activation of voltage-gated Ca2+ channels along the length of
the flagellum (Collingridge et al. 2013). Further characterisation of the signal
transduction pathway regulating gliding motility is likely to yield important broader
insights into the nature of ciliary signalling.
3.3 Deflagellation
The process of flagellar excision is another flagella-related signalling pathway that

has been extensively characterised in Chlamydomonas. Cells exposed to various
stressors including chemicals (such as dibucaine and mastoparan), pH shock,
elevated temperature and mechanical shear rapidly shed both flagella by precise
severing of the nine outer doublet microtubules at the distal end of the flagella
transition zone (Quarmby 2004). This process has been much exploited by
Chlamydomonas researchers in order to obtain large quantities of flagella for
biochemical characterisation of their component proteins. It is presumed that
deflagellation contributes to survival in unfavourable conditions, e.g. by reducing
the surface area of exposed cellular membranes, although there is little experimen-
tal evidence to support this. The microtubule-severing activity is directly dependent
on Ca2+, as axonemal severing can be induced in purified axonemes/basal bodies
exposed to 1 μM Ca2+ (Lohret et al. 1998). How exactly Ca2+ triggers the severing
process is not yet clear. The Ca2+-binding protein centrin may contribute to flagellar
excision through contraction of the stellate fibres in the distal flagella transition
zone. However, the centrin mutant vfl2 deflagellates normally suggesting that the
activity of centrin alone does not induce microtubule severing (Quarmby 2004).
Katanin is a likely candidate for the microtubule-severing protein, although katanin
likely plays further roles in the cell and conclusive evidence supporting a role for
katanin in deflagellation is lacking (Lohret et al. 1998; Rasi et al. 2009).
Treatment of Chlamydomonas cells with organic acids, such as benzoate or

acetate, results in cytosolic acidification, which rapidly leads to deflagellation
(Braun and Hegemann 1999; Quarmby 1996). Quarmby and Hartzell (1994) dem-
onstrated that acid-induced deflagellation is completely dependent on a Ca2+ influx
across the plasma membrane and does not occur in the absence of external Ca2+.
Cytosolic acidification due to organic acids also causes activation of phospholipase
C and an accumulation of inositol triphosphate (IP3), which may play a role in the
deflagellation signalling pathway (Quarmby et al. 1992). Mastoparan, a G-protein
agonist that stimulates intracellular Ca2+ release through elevation of IP3,
deflagellates cells in the absence of external Ca2+, suggesting that deflagellation
can also result from the release of Ca2+ from internal stores (Quarmby and Hartzell
1994). However, the evidence for the role of IP3 in the signalling pathway remains
inconclusive (Quarmby 2004).
Direct imaging of cytosolic Ca2+ demonstrates that organic acids cause a rapid
and sustained elevation in [Ca2+]cyt throughout the cytosol, which coincides with the
timing of flagellar excision (Braun and Hegemann 1999; Wheeler et al. 2008). The
adf1 mutant, which is defective in acid-induced deflagellation but deflagellates
normally in response to other stimuli, does not exhibit a Ca2+ influx in response to
acid or demonstrate the [Ca2+]cyt elevation (Finst et al. 2000; Quarmby and Hartzell
1994; Wheeler et al. 2008). The absence of a Ca2+ influx led to proposals that ADF1
encodes a H+-stimulated Ca2+ channel localised to the apical region of the cell
(Quarmby and Hartzell 1994). Recently, a combination of genetic mapping and
whole genome sequencing of adf1 mutants identified Adf1 as a member of the TRP
family of ion channels (Hilton et al. 2016). Closer examination of the adf1 mutant
revealed that a small percentage of cells do deflagellate during benzoate addition,
and in each of these instances, a localised transient [Ca2+]cyt elevation was observed
in the apical region of the cell coinciding with deflagellation (Wheeler et al. 2008).
Assuming Adf1 is a Ca2+-permeable ion channel, its reduced activity in the adf1-1
mutant may result in greatly reduced Ca2+ influx in the apical region, leading to a
transient localised [Ca2+]cyt elevation that is sufficient to cause flagellar excision but
does not trigger further Ca2+ release from intracellular stores. This indicates that
deflagellation can be induced solely by a localised [Ca2+]cyt elevation in the region
around the basal body and does not require the whole cell [Ca2+]cyt elevation
normally observed in wild-type cells. It is likely that additional inputs are required in
the signalling pathway before Ca2+ can act to trigger flagellar excision. Rapid addition
of 20 mM external Ca2+ to Chlamydomonas causes a series of repetitive [Ca2+]cyt
elevations and leads to deflagellation (Fig. 3) (Wheeler et al. 2008). However,
whilst each deflagellation event was observed to coincide with a [Ca2+]cyt elevation,
many cells exhibited multiple [Ca2+]cyt elevations prior to flagellar excision indi-
cating that [Ca2+]cyt elevations alone do not induce deflagellation in an intact cell.
One additional component of the deflagellation signalling pathway is the aurora
protein kinase CALK, which has a role in the regulating flagellar length and
assembly. CALK is phosphorylated during acid-induced deflagellation, and RNAi-
mediated knockdown of CALK led to defects in deflagellation (Pan et al. 2004),
although how CALK interacts with the Ca2+ signalling pathway is not known. As
244 G.L. Wheeler
A Oregon Green BAPTA Chlorophyll Merge
13.9 s 14.1 14.3 14.5 14.7 14.9
0.9 1.5
1.2
20 mM CaCl2
F ratio (OG/TR)
1.1
1.0
-15 0 15 30 45 60 75
Time (s)
Fig. 3 Imaging [Ca2+]cyt elevations in Chlamydomonas. (a) Confocal microscopic images of a

Chlamydomonas cell loaded with the Ca2+-responsive dye Oregon Green BAPTA dextran. The
dextran-conjugated dye demonstrates diffuse cytoplasmic loading, with no compartmentalisation.
Chlorophyll autofluorescence is also shown. Bar ¼ 10 μm. (b) An example of the [Ca2+]cyt
elevations induced by adding 20 mM external Ca2+ to a Chlamydomonas cell. The upper images
show changes in Oregon Green BAPTA fluorescence viewed by epifluorescent microscopy.
Images are generated by dividing each image by a rolling median image (n ¼ 20 images) and
are pseudo-coloured to illustrate relative changes in fluorescence. The lower graph shows the
corresponding changes in the fluorescence ratio of Oregon Green BAPTA (OG) and a
non-responsive dye, Texas Red (TR), for the same cell. Perfusion of the cell with 20 mM external
Ca2+ for 30 s results in a series of [Ca2+]cyt elevations that persist after the cell is returned to the
initial external Ca2+ (300 μM). Bar ¼ 10 μm
[Ca2+]cyt elevations are linked to many different stress responses, understanding

their interactions with other signalling components is critical in determining the
specificity of Ca2+ signalling.
3.4 The Role of Ca2+ in Flagellar Length
In addition to its central role in the process of flagellar excision, Ca2+ also
contributes to the regulation of gene expression during flagellar regrowth (Cheshire
and Keller 1991). Acid-induced deflagellation is followed by the rapid accumula-
tion of transcripts for many flagella-related genes, and the increase is dependent on
external Ca2+ (Evans and Keller 1997). The induction of gene expression is also
greatly reduced in the presence of inhibitors of Ca2+ channels and in the adf1
mutant, although these also exhibit decreased deflagellation (Evans and Keller
1997). However, deflagellation of Chlamydomonas cells by mechanical shear in
the absence of Ca2+ prevents the upregulation of flagella-related gene transcripts,
indicating that Ca2+ entry is required for the transcriptional response (Cheshire et al.
1994; Cheshire and Keller 1991).
There is also a direct requirement for Ca2+ in flagellar regrowth and length
control. In low external Ca2+ (<0.15 μM), deflagellated cells do not regrow flagella
at all until Ca2+ is restored to c. >0.5 μM (Cheshire and Keller 1991; Liang and Pan
2013). Ca2+ also appears to be required for the maintenance of flagellar length, as
cells placed in very low Ca2+ media containing 25 mM Na+ or K+ will resorb their
flagella (Lefebvre et al. 1978). Chlamydomonas pf18 (paralysed flagella) cells have
longer flagella when grown in elevated Ca2+ (2 mM), but they also produce longer
flagella in the presence of Ca2+ channel blockers (La3+ and Cd2+), which makes this
result difficult to interpret (Tuxhorn et al. 1998). However, mammalian IMCD
(immortalised kidney-collecting duct) cells treated with 30 μM Gd3+ (a non-specific
blocker of Ca2+ channels) also show elongated cilia, suggesting that the effect of
lanthanides on ciliary length may be conserved in eukaryotes (Besschetnova et al.
2010). Whilst it is not clear exactly how intraflagellar Ca2+ acts to regulate flagellar
length in Chlamydomonas, significant recent progress has been made in identifying a
requirement for Ca2+ sensor kinases. Chlamydomonas contains an expanded family
of 14 Ca2+-dependent protein kinases (CDPK), which possess an N-terminal serine/
threonine kinase and 4 Ca2+-binding EF hands at the C-terminus (Edel and Kudla
2015). Three CDPKs (CDPK1, CDPK3 and CDPK11) were identified in the flagellar
proteome, suggesting a probable role in flagella function (Liang and Pan 2013;
Pazour et al. 2005). RNAi knockdown strains for CDPK3 showed slow regrowth
of flagella at low concentrations of external Ca2+, but flagellar length, motility and
mating were unaffected (Liang and Pan 2013). In contrast, RNAi knockdown of
CDPK1 led to significantly reduced flagellar length and defects in IFT (Liang et al.
2014). CDPK1 acts to phosphorylate the FLA8 subunit of the microtubule motor
protein kinesin-II, which disrupts the interaction between kinesin and the IFT-B
subunit of the IFT particle. The phosphorylation of FLA8 by CDPK1 appears to
block entry of kinesin into the flagella but also promotes dissociation of kinesin from
the IFT-B particle at the flagellar tip. As a consequence, CDPK1 RNAi strains
accumulate FLA8 and components of the IFT particle at the flagellar tip (Liang
et al. 2014). These findings indicate that Ca2+ sensor kinases play an important role
in flagellar length assembly and length control. As Ca2+ plays a direct role in the
246 G.L. Wheeler
regulation of IFT during gliding motility (Collingridge et al. 2013), it will be

interesting to determine whether the directed movement of IFT particles also
contributes to flagellar length control.
4 Cytosolic Ca2+ Signalling During Stress Responses
Compared to the wealth of evidence examining the diverse roles of Ca2+ in flagella
function, there is relatively little information on the nature of the Ca2+-dependent
signalling processes in the cell body. However, there has been some important
recent progress, most notably in examining the link between Ca2+ and photosyn-
thesis. In land plants, Ca2+ signalling plays a central role in the response to many
different environmental stimuli, including osmotic stress, oxidative stress, temper-
ature and biotic stimuli, and the dynamics of the [Ca2+]cyt elevations associated
with each stimulus have been characterised in detail (Kiegle et al. 2000; Knight
et al. 1997; Takahashi et al. 1997). In contrast, there have been very few studies
involving direct imaging of [Ca2+]cyt in green algae, and our understanding of the
nature of [Ca2+]cyt elevations in Chlamydomonas remains in its infancy (Bauer
et al. 1997; Braun and Hegemann 1999; Thompson et al. 2007). A recent study
demonstrated that different osmotic stimuli give rise to distinct [Ca2+]cyt elevations
in Chlamydomonas, although [Ca2+]cyt elevations were not observed in response to
oxidative stress from hydrogen peroxide (Bickerton et al. 2016). Hyperosmotic
shock through the addition of NaCl resulted in a single [Ca2+]cyt elevation that
originated in the apex of the cell and rapidly propagated to the rest of the cytoplasm,
resembling the well-characterised Ca2+ waves observed in animal cells. The timing
and amplitude of the [Ca2+]cyt elevation were dependent on the intensity of the
stimulus. In contrast, hypoosmotic shocks induced by very dilute media or
deionised water resulted in a series of repetitive [Ca2+]cyt elevations (Bickerton
et al. 2016). Hypoosmotic shock also induced repetitive [Ca2+]fla elevations, but
these did not coincide with the [Ca2+]cyt elevations, suggesting that the flagella and
the cytosol can respond independently to this stimulus (Bickerton et al. 2016). The
requirement for Ca2+ in the osmotic signalling response appears to be conserved
between Chlamydomonas and land plants, although the spatial and temporal nature
of the resultant [Ca2+]cyt elevations is distinct.
The [Ca2+]cyt elevations observed in response to NaCl stress and hypoosmotic
shock were both severely inhibited in the absence of external Ca2+, suggesting an
important role for Ca2+ entry across the plasma membrane in the initiation of the
signalling response. However, it is likely that these [Ca2+]cyt elevations involve further
release of Ca2+ from intracellular stores following the initial Ca2+ entry (e.g. during
propagation of the Ca2+ wave). A major internal store of Ca2+ in Chlamydomonas is
likely to be the acidocalcisomes, which play a direct role in Ca2+ signalling in a range
of other protists (Docampo and Huang 2016; Ruiz et al. 2001). Acidocalcisomes are
numerous small low-pH vesicles that are rich in polyphosphate, Ca2+ and a range of
other metal ions. Recent evidence in Chlamydomonas suggests that the
acidocalcisomes play an important role in cell survival during nutrient deficiency

(sulphate, nitrate, phosphate) and are also used for the storage of metals such as zinc
and copper (Aksoy et al. 2014; Hong-Hermesdorf et al. 2014). In trypanosomes and
apicomplexan parasites, Ca2+ entry into acidocalcisomes is mediated by the action of
Ca2+ ATPases, although it is likely that Ca2+/H+ antiporters also contribute to Ca2+
uptake (Docampo and Huang 2016). Chlamydomonas possesses three CAX Ca2+/H+
antiporters (Emery et al. 2012), although it is not known whether any of these localise
to the acidocalcisomes. Characterisation of Chlamydomonas CAX1 identified some
unusual properties, as CAX1 exhibits Na+/H+ exchange activity in addition to Ca2+/H+
exchange (Pittman et al. 2009). CAX1 may therefore contribute to Na+ efflux during
salt stress, in addition to its likely role in Ca2+ homeostasis. However, CAX1 expres-
sion was repressed by high concentrations of Ca2+ or Na+, suggesting that it is unlikely
to function primarily in the sequestration of excess Na+ or Ca2+ (Pittman et al. 2009).
5 Ca2+ Signalling and Photosynthesis
One emerging area of significant interest in Chlamydomonas is the role of Ca2+ in

regulating photosynthesis. An early report suggested that Ca2+ and CaM played a
role in regulating the biosynthesis of chlorophyll by contributing to the transcrip-
tional regulation of glutamate-1-semialdehyde aminomutase by blue light
(Im et al. 1996). More recently, a direct link to Ca2+-dependent regulation of
photosynthesis has emerged through studies of the Ca2+-sensor protein, CAS.
CAS was initially identified in land plants as a sensor of external Ca2+ but was
subsequently shown to localise to the thylakoid membranes and play a major role
in the modulation of [Ca2+]cyt elevations in stomatal guard cells (Nomura et al.
2008; Weinl et al. 2008). CAS also localises to the thylakoid membranes in
Chlamydomonas and plays an important role in photoprotection through its role
in the accumulation of LHCSR3 in high light (Petroutsos et al. 2011). LHCSR3 is
a light-harvesting protein that is required for the dissipation of excess light energy
through non-photochemical quenching (NPQ). CAS RNAi knockdown strains
exhibit low levels of LHCSR3 and defects in NPQ, although both of these
phenotypes can be rescued by the addition of 3 mM Ca2+ in the external media
(Petroutsos et al. 2011). LHCSR3 is encoded by two genes LHCSR3.1 and
LHCSR3.2 that produce an identical amino acid product, and both genes appear
to be transcriptionally regulated by Ca2+ (Maruyama et al. 2014). Under anoxic
conditions, CAS RNAi knockdown strains show a strong inhibition of cyclic
electron flow (CEF) in photosystem I, which in wild-type cells is required for
the generation of the pH gradient across the thylakoid membrane during NPQ
(Terashima et al. 2012). CAS was shown to form a complex with a novel protein
ANR1 and with PGR5-Like 1 (PGRL1), a protein that is required for normal CEF
in land plants (Terashima et al. 2012). Recently, a novel class of Ca2+-sensor
proteins has also been described in Chlamydomonas. Calredoxin (CRX) possesses
a unique combination of four Ca2+-binding EF hands at the N-terminus and a
248 G.L. Wheeler
C-terminal thioredoxin domain and was localised to the chloroplast stroma

(Hochmal et al. 2016). CRX interacts with a 2-cys peroxiredoxin in a Ca2+-
dependent manner in order to drive the detoxification of hydrogen peroxide. CRX
mutant and RNAi knockdown strains are not defective in the induction of
LHCSR3 expression under high light but exhibit increased CEF (Hochmal et al.
2016). Together, these findings illustrate that Chlamydomonas is a very useful
model to study the Ca2+-dependent regulation of photosynthesis and its associated
photoprotective mechanisms.
6 Evolution of the Ca2+ Signalling Toolkit
The sequencing of the Chlamydomonas genome and further advances in algal

genomics have provided important insight into the evolution of the Ca2+ signalling
in the green algae. Land plant genomes lack clear homologues of several classes of
ion channel that are central to Ca2+ signalling in animal cells, including the four-
domain voltage-dependent Ca2+ channels (VDCC), transient receptor potential
(TRP) channels and the inositol triphosphate receptor (IP3R) (Edel and Kudla
2015; Verret et al. 2010; Wheeler and Brownlee 2008). Instead, land plants possess
an extended family of cyclic nucleotide-gated channels and ionotropic glutamate
receptors (Swarbreck et al. 2013). In contrast, green algae possess multiple homo-
logues of the well-characterised ‘animal-like’ Ca2+ channels that are absent from
land plants, and experimental evidence indicates that members of the VDCC and
TRP classes of ion channel play important roles in signal transduction in
Chlamydomonas (Arias-Darraz et al. 2015; Fujiu et al. 2009, 2011; Huang et al.
2007; Merchant et al. 2007; Wheeler and Brownlee 2008). The broad distribution of
these channels in the green algae and other eukaryote lineages suggests that they
have been specifically lost in the land plants. Identification of their functional roles
in Chlamydomonas and other green algae will be important in understanding the
evolutionary processes leading to the loss of these Ca2+ channels in the land plants.
The mechanisms through which Ca2+ signals are generated in green algae are
therefore very different from those found in land plants. Significant differences in
the mechanisms that sense Ca2+are also found between these lineages. Land plants
have an expanded family of CaMs and CaM-like (CML) proteins, with a total of
58 proteins present in Arabidopsis. Whilst CaM is highly conserved amongst
eukaryotes, CML is absent from animals and this family has become greatly
expanded in the land plants. Chlamydomonas possesses a CaM homologue and
eight CMLs belonging to 1c and III (Zhu et al. 2015). This complement is similar to
the charophyte Klebsormidium suggesting that the major diversification of the
CMLs into multiple subgroups occurred after this lineage diverged from the land
plants (Zhu et al. 2015). Land plants also possess an expanded repertoire of Ca2+-
sensor kinases. For example, Arabidopsis has 34 CDPKs, 26 CIPKs and 10 CBLs
(Edel and Kudla 2015). Whilst Chlamydomonas has 15 CDPKs, the CIPKs and their
binding partner the CBLs appear to be absent, along with the CCaMKs. CIPKs/
CBLs are not specific to the land plants though, as a single CIPK and a CBL are
present in Ostreococcus (Edel and Kudla 2015). This suggests that the CIPKs may
have been lost in an ancestor of Chlamydomonas, although greater taxonomic
sampling of other green algal lineages is required to resolve this. One of the
Chlamydomonas CDPKs has unique domain architecture, possessing a C2 domain
at the N-terminus (Hamel et al. 2014). C2 domains are often involved in Ca2+-
dependent membrane interactions, and this unique C2-CDPK was only found in
other members of the Volvocales, suggesting that a single gene fusion event gave
rise to this novel protein (Hamel et al. 2014).
7 Technical Considerations for the Study of Ca2+

Signalling in Chlamydomonas
The studies listed above illustrate just how many diverse processes are regulated by
Ca2+ in Chlamydomonas. Whilst significant progress has now been made in
characterising these signalling pathways, a fuller understanding of the role of Ca2+
in these signalling pathways has been hampered by the technical issues associated
with Ca2+ imaging in Chlamydomonas. As with many plant and algal cells, loading
of Ca2+-responsive fluorescent dyes via membrane-permeant acetoxymethyl
(AM) esters is problematic, due to unequal loading and dye compartmentalisation
(Braun and Hegemann 1999). For example, the AM ester of the Ca2+-responsive dye
Fluo-4 was found to localise to the acidocalcisomes in Chlamydomonas (Hong-
Hermesdorf et al. 2014). Because of these problems, the use of ester-loaded dyes for
the examination of [Ca2+]cyt dynamics, particularly over longer timescales or in
fluorimetric approaches (rather than direct single cell imaging), is not
recommended. Dextran-conjugated dyes are not subject to compartmentalisation
as they are membrane impermeable, but they require specialised techniques in order
to load them into intact cells. Microinjection is clearly not appropriate for small algal
cells, but a biolistic delivery method for dextran-conjugated dyes into
Chlamydomonas has been developed that provides robust and reproducible cyto-
plasmic dye loading (Bothwell et al. 2006; Wheeler and Brownlee 2008). Although
this technique has proven to be reliable, there are clearly some disadvantages
associated with this delivery method, such as the equipment and technical expertise
required and the low proportion of cells that are loaded. Therefore, the future
development of genetically encoded calcium indicators in Chlamydomonas is of
top priority in order to advance this field. GECIs not only allow for simple routine
imaging of [Ca2+]cyt, they may also be targeted to specific cellular locations (e.g. the
mitochondria or the chloroplast) to enable the study of localised or intra-organellar
[Ca2+]cyt elevations. It is important to note that GECIs will be an important addi-
tional tool to be used alongside Ca2+-responsive fluorescent dyes in
Chlamydomonas, as the properties (e.g. Ca2+ dissociation kinetics, pH sensitivity)
of certain dyes may make them a preferred choice for certain applications, such as
250 G.L. Wheeler
the observation of the very rapid flagellar Ca2+ elevations (Chen et al. 2013; Hendel
et al. 2008). Whilst the development of further robust protocols for Ca2+ imaging is
likely to be of greatest benefit in this field, the ability to perform electrophysiological
studies in Chlamydomonas should not be overlooked. Much of our knowledge on
flagellar signalling in Chlamydomonas originates from these approaches, and their
application led to the discovery of channelrhodopsin.
8 Concluding Remarks
The broad scope of this review demonstrates the wide-reaching influence of Ca2+-
dependent signalling processes on the cell biology of Chlamydomonas. Significant
progress has now been made in identifying the molecular mechanisms and physio-
logical processes associated with diverse signalling pathways. However, there is
clearly much to be learnt and our knowledge of Ca2+ signalling in Chlamydomonas
remains limited. In particular, whilst individual components of some signalling
pathways have now been identified, e.g. the ion channels, the Ca2+ elevations or
the Ca2+ sensors, there are very few examples where all of these aspects have been
characterised and compiled into working knowledge of the whole pathway. To some
extent, this is partially true for the land plants, where the molecular identification of
the specific Ca2+ channels responsible for well-characterised ion currents and Ca2+
elevations has proven to be problematic (Swarbreck et al. 2013). The reduced
complexity of the Ca2+ signalling toolkit in Chlamydomonas may allow for simpler
resolution of these issues. Chlamydomonas has already proven to be an important
model for the study of signalling processes relating to flagella and photosynthesis.
Studies in Chlamydomonas have also contributed important information on the
evolution of Ca2+ signalling. Together these studies have revealed many surprising
and novel aspects of the Ca2+-dependent signalling pathways in Chlamydomonas,
and there are likely to be many more exciting discoveries in the future.
References
Aksoy M, Pootakham W, Grossman AR (2014) Critical function of a Chlamydomonas reinhardtii

putative polyphosphate polymerase subunit during nutrient deprivation. Plant Cell 26:4214–4229
Arias-Darraz L, Cabezas D, Colenso CK, Alegria-Arcos M, Bravo-Moraga F, Varas-Concha I,
Almonacid DE, Madrid R, Brauchi S (2015) A transient receptor potential ion channel in
Chlamydomonas shares key features with sensory transduction-associated TRP channels in
mammals. Plant Cell 27:177–188
Bauer CS, Plieth C, Hansen UP, Sattelmacher B, Simonis W, Schonknecht G (1997) Repetitive
Ca2þ spikes in a unicellular green alga. FEBS Lett 405:390–393
Berthold P, Tsunoda SP, Ernst OP, Mages W, Gradmann D, Hegemann P (2008) Channelrhodopsin-1
initiates phototaxis and photophobic responses in Chlamydomonas by immediate light-induced
depolarization. Plant Cell 20:1665–1677
Besschetnova TY, Kolpakova-Hart E, Guan Y, Zhou J, Olsen BR, Shah JV (2010) Identification of
signaling pathways regulating primary cilium length and flow-mediated adaptation. Curr Biol
20:182–187
Bessen M, Fay RB, Witman GB (1980) Calcium control of waveform in isolated flagellar
axonemes of Chlamydomonas. J Cell Biol 86:446–455
Bickerton P, Sello S, Brownlee C, Pittman JK, Wheeler GL (2016) Spatial and temporal specificity of
Ca2+ signalling in Chlamydomonas reinhardtii in response to osmotic stress. New Phytol 212
(4):920–933
Bloodgood RA (1981) Flagella-dependent gliding motility in Chlamydomonas. Protoplasma
106:183–192
Bloodgood RA (1995) Flagellar surface motility: gliding and microsphere movements. Methods
Cell Biol 47:273–279
Bloodgood RA (2009) The Chlamydomonas flagellar membrane and its dynamic properties. In:
Witman GB (ed) The Chlamydomonas sourcebook. Academic, Oxford, pp 309–368
Bloodgood RA, Salomonsky NL (1990) Calcium influx regulates antibody-induced glycoprotein
movements within the Chlamydomonas flagellar membrane. J Cell Sci 96(Pt 1):27–33
Bloodgood RA, Workman LJ (1984) A flagellar surface glycoprotein mediating cell-substrate
interaction in Chlamydomonas. Cell Motil 4:77–87
Bothwell JHF, Brownlee C, Hetherington AM, Ng CKY, Wheeler GL, McAinsh MR (2006)
Biolistic delivery of Ca2þ dyes into plant and algal cells. Plant J 46:327–335
Braun FJ, Hegemann P (1999) Direct measurement of cytosolic calcium and pH in living
Chlamydomonas reinhardtii cells. Eur J Cell Biol 78:199–208
Brownlee C (1994) Tansley review No-70 – signal-transduction during fertilization in algae and
vascular plants. New Phytol 127:399–423
Casey DM, Inaba K, Pazour GJ, Takada S, Wakabayashi K, Wilkerson CG, Kamiya R, Witman
GB (2003a) DC3, the 21-kDa subunit of the outer dynein arm-docking complex (ODA-DC), is
a novel EF-hand protein important for assembly of both the outer arm and the ODA-DC. Mol
Biol Cell 14:3650–3663
Casey DM, Yagi T, Kamiya R, Witman GB (2003b) DC3, the smallest subunit of the Chlamydomonas
flagellar outer dynein arm-docking complex, is a redox-sensitive calcium-binding protein. J Biol
Chem 278:42652–42659
Chen TW, Wardill TJ, Sun Y, Pulver SR, Renninger SL, Baohan A, Schreiter ER, Kerr RA, Orger
MB, Jayaraman V et al (2013) Ultrasensitive fluorescent proteins for imaging neuronal
activity. Nature 499:295–300
Cheshire JL, Keller LR (1991) Uncoupling of Chlamydomonas flagellar gene expression and
outgrowth from flagellar excision by manipulation of Ca2þ. J Cell Biol 115:1651–1659
Cheshire JL, Evans JH, Keller LR (1994) Ca2þ signaling in the Chlamydomonas flagellar
regeneration system: cellular and molecular responses. J Cell Sci 107(Pt 9):2491–2498
Collingridge P, Brownlee C, Wheeler GL (2013) Compartmentalized calcium signaling in cilia
regulates intraflagellar transport. Curr Biol 23:2311–2318
DeCoursey TE (2013) Voltage-gated proton channels: molecular biology, physiology, and pathophys-
iology of the H(V) family. Physiol Rev 93:599–652
DiPetrillo CG, Smith EF (2010) Pcdp1 is a central apparatus protein that binds Ca(2þ)-calmodulin
and regulates ciliary motility. J Cell Biol 189:601–612
DiPetrillo CG, Smith EF (2013) Methods for analysis of calcium/calmodulin signaling in cilia and
flagella. Methods Enzymol 524:37–57
Docampo R, Huang G (2016) Acidocalcisomes of eukaryotes. Curr Opin Cell Biol 41:66–72
Dymek EE, Smith EF (2007) A conserved CaM- and radial spoke associated complex mediates
regulation of flagellar dynein activity. J Cell Biol 179:515–526
Edel KH, Kudla J (2015) Increasing complexity and versatility: how the calcium signaling toolkit
was shaped during plant land colonization. Cell Calcium 57:231–246
Ehlenbeck S, Gradmann D, Braun FJ, Hegemann P (2002) Evidence for a light-induced H(þ)
conductance in the eye of the green alga Chlamydomonas reinhardtii. Biophys J 82:740–751
252 G.L. Wheeler
Emery L, Whelan S, Hirschi KD, Pittman JK (2012) Protein phylogenetic analysis of Ca(2þ)/
cation antiporters and insights into their evolution in plants. Front Plant Sci 3:1
Ermilova E, Zalutskaya Z, Munnik T, van den Ende H, Gromov B (1998) Calcium in the control of
chemotaxis in Chlamydomonas. Biologia 53:577–581
Evans JH, Keller LR (1997) Calcium influx signals normal flagellar RNA induction following acid
shock of Chlamydomonas reinhardtii. Plant Mol Biol 33:467–481
Finst RJ, Kim PJ, Griffis ER, Quarmby LM (2000) Fa1p is a 171 kDa protein essential for
axonemal microtubule severing in Chlamydomonas. J Cell Sci 113(Pt 11):1963–1971
Foster KW, Smyth RD (1980) Light antennas in phototactic algae. Microbiol Rev 44:572–630
Fujiu K, Nakayama Y, Yanagisawa A, Sokabe M, Yoshimura K (2009) Chlamydomonas CAV2
encodes a voltage- dependent calcium channel required for the flagellar waveform conversion.
Curr Biol 19:133–139
Fujiu K, Nakayama Y, Iida H, Sokabe M, Yoshimura K (2011) Mechanoreception in motile
flagella of Chlamydomonas. Nat Cell Biol 13:630–632
Goodenough UW, Shames B, Small L, Saito T, Crain RC, Sanders MA, Salisbury JL (1993) The
role of calcium in the Chlamydomonas reinhardtii mating reaction. J Cell Biol 121:365–374
Govorunova EG, Sineshchekov OA (2003) Integration of photo- and chemosensory signaling
pathways in Chlamydomonas. Planta 216:535–540
Govorunova EG, Sineshchekov OA (2005) Chemotaxis in the green flagellate alga
Chlamydomonas. Biochemistry (Mosc) 70:717–725
Hamel LP, Sheen J, Seguin A (2014) Ancient signals: comparative genomics of green plant
CDPKs. Trends Plant Sci 19:79–89
Harz H, Hegemann P (1991) Rhodopsin-regulated calcium currents in Chlamydomonas. Nature
351:489–491
Hegemann P, Berthold P (2009) Sensory photoreceptors and light control of flagellar activity. In:
Witman GB (ed) The Chlamydomonas sourcebook. Academic, Oxford, pp 395–429
Hendel T, Mank M, Schnell B, Griesbeck O, Borst A, Reiff DF (2008) Fluorescence changes of
genetic calcium indicators and OGB-1 correlated with neural activity and calcium in vivo and
in vitro. J Neurosci 28:7399–7411
Hill K, Hemmler R, Kovermann P, Calenberg M, Kreimer G, Wagner R (2000) A Ca(2þ)- and
voltage-modulated flagellar ion channel is a component of the mechanoshock response in the
unicellular green alga Spermatozopsis similis. Biochim Biophys Acta 1466:187–204
Hilton LK, Meili F, Buckoll PD, Rodriguez-Pike JC, Choutka CP, Kirschner JA, Warner F, Lethan
M, Garces FA, Qi J, Quarmby LM (2016) A forward genetic screen and whole genome
sequencing identify deflagellation defective mutants in Chlamydomonas, including assignment
of ADF1 as a TRP channel. G3 6(10):3409–3418
Hochmal AK, Zinzius K, Charoenwattanasatien R, Gabelein P, Mutoh R, Tanaka H, Schulze S, Liu G,
Scholz M, Nordhues A et al (2016) Calredoxin represents a novel type of calcium-dependent
sensor-responder connected to redox regulation in the chloroplast. Nat Commun 7:11847
Holland EM, Braun FJ, Nonnengasser C, Harz H, Hegemann P (1996) Nature of rhodopsin-triggered
photocurrents in Chlamydomonas.1. Kinetics and influence of divalent ions. Biophys J 70:924–931
Holland EM, Harz H, Uhl R, Hegemann P (1997) Control of phobic behavioral responses by
rhodopsin-induced photocurrents in Chlamydomonas. Biophys J 73:1395–1401
Domaille DW, Shirasaki DI, Loo JA et al (2014) Subcellular metal imaging identifies dynamic
sites of Cu accumulation in Chlamydomonas. Nat Chem Biol 10:1034–1042
Horst CJ, Witman GB (1993) ptx1, a nonphototactic mutant of Chlamydomonas, lacks control of
flagellar dominance. J Cell Biol 120:733–741
Huang K, Diener DR, Mitchell A, Pazour GJ, Witman GB, Rosenbaum JL (2007) Function and
dynamics of PKD2 in Chlamydomonas reinhardtii flagella. J Cell Biol 179:501–514
Hyams JS, Borisy GG (1978) Isolated flagellar apparatus of Chlamydomonas: characterization of
forward swimming and alteration of waveform and reversal of motion by calcium ions in vitro.
J Cell Sci 33:235–253
Im CS, Matters GL, Beale SI (1996) Calcium and calmodulin are involved in blue light induction
of the gsa gene for an early chlorophyll biosynthetic step in Chlamydomonas. Plant Cell
8:2245–2253
Kam V, Moseyko N, Nemson J, Feldman LJ (1999) Gravitaxis in Chlamydomonas reinhardtii:
characterization using video microscopy and computer analysis. Int J Plant Sci 160:1093–1098
Kamiya R, Okamoto M (1985) A mutant of Chlamydomonas reinhardtii that lacks the flagellar
outer dynein arm but can swim. J Cell Sci 74:181–191
Kamiya R, Witman GB (1984) Submicromolar levels of calcium control the balance of beating
between the 2 flagella in demembranated models of Chlamydomonas. J Cell Biol 98:97–107
Kiegle E, Moore CA, Haseloff J, Tester MA, Knight MR (2000) Cell-type-specific calcium
responses to drought, salt and cold in the Arabidopsis root. Plant J 23:267–278
Knight H, Trewavas AJ, Knight MR (1997) Calcium signalling in Arabidopsis thaliana
responding to drought and salinity. Plant J 12:1067–1078
Kreimer G, Witman GB (1994) Novel touch-induced, Ca(2þ)-dependent phobic response in a
flagellate green alga. Cell Motil Cytoskeleton 29:97–109
Lefebvre PA, Nordstrom SA, Moulder JE, Rosenbaum JL (1978) Flagellar elongation and shortening
in Chlamydomonas. IV. Effects of flagellar detachment, regeneration, and resorption on the
induction of flagellar protein synthesis. J Cell Biol 78:8–27
Liang Y, Pan J (2013) Regulation of flagellar biogenesis by a calcium dependent protein kinase in
Chlamydomonas reinhardtii. PLoS One 8:e69902
Liang Y, Pang Y, Wu Q, Hu Z, Han X, Xu Y, Deng H, Pan J (2014) FLA8/KIF3B phosphorylation
regulates kinesin-II interaction with IFT-B to control IFT entry and turnaround. Dev Cell
30:585–597
Lohret TA, McNally FJ, Quarmby LM (1998) A role for katanin-mediated axonemal severing
during Chlamydomonas deflagellation. Mol Biol Cell 9:1195–1207
Maruyama S, Tokutsu R, Minagawa J (2014) Transcriptional regulation of the stress-responsive
light harvesting complex genes in Chlamydomonas reinhardtii. Plant Cell Physiol
55:1304–1310
Matsuda A, Yoshimura K, Sineshchekov OA, Hirono M, Kamiya R (1998) Isolation and character-
ization of novel Chlamydomonas mutants that display phototaxis but not photophobic response.
Cell Motil Cytoskeleton 41:353–362
McAinsh MR, Pittman JK (2009) Shaping the calcium signature. New Phytol 181:275–294
Fritz-Laylin LK, Marechal-Drouard L et al (2007) The Chlamydomonas genome reveals the
evolution of key animal and plant functions. Science 318:245–250
Nagel G, Ollig D, Fuhrmann M, Kateriya S, Mustl AM, Bamberg E, Hegemann P (2002)
Channelrhodopsin-1: a light-gated proton channel in green algae. Science 296:2395–2398
Nagel G, Szellas T, Huhn W, Kateriya S, Adeishvili N, Berthold P, Ollig D, Hegemann P,
Bamberg E (2003) Channelrhodopsin-2, a directly light-gated cation-selective membrane
channel. Proc Natl Acad Sci U S A 100:13940–13945
Nomura H, Komori T, Kobori M, Nakahira Y, Shiina T (2008) Evidence for chloroplast control of
external Ca2þ-induced cytosolic Ca2þ transients and stomatal closure. Plant J 53:988–998
Nonnengasser C, Holland EM, Harz H, Hegemann P (1996) The nature of rhodopsin-triggered
photocurrents in Chlamydomonas. II. Influence of monovalent ions. Biophys J 70:932–938
Okita N, Isogai N, Hirono M, Kamiya R, Yoshimura K (2005) Phototactic activity in
Chlamydomonas ‘non-phototactic’ mutants deficient in Ca2þ-dependent control of flagellar
dominance or in inner-arm dynein. J Cell Sci 118:529–537
Pan J, Snell WJ (2000) Signal transduction during fertilization in the unicellular green alga,
Chlamydomonas. Curr Opin Microbiol 3:596–602
Pan J, Wang Q, Snell WJ (2004) An aurora kinase is essential for flagellar disassembly in
Chlamydomonas. Dev Cell 6:445–451
Pasquale SM, Goodenough UW (1987) Cyclic AMP functions as a primary sexual signal in
gametes of Chlamydomonas reinhardtii. J Cell Biol 105:2279–2292
254 G.L. Wheeler
Patel-King RS, Gorbatyuk O, Takebe S, King SM (2004) Flagellar radial spokes contain a
Ca2þ-stimulated nucleoside diphosphate kinase. Mol Biol Cell 15:3891–3902
Pazour GJ, Agrin N, Leszyk J, Witman GB (2005) Proteomic analysis of a eukaryotic cilium. J Cell
Biol 170:103–113
Petroutsos D, Busch A, Janssen I, Trompelt K, Bergner SV, Weinl S, Holtkamp M, Karst U,
Kudla J, Hippler M (2011) The chloroplast calcium sensor CAS is required for
photoacclimation in Chlamydomonas reinhardtii. Plant Cell 23:2950–2963
Pittman JK, Edmond C, Sunderland PA, Bray CM (2009) A cation-regulated and proton
gradient-dependent cation transporter from Chlamydomonas reinhardtii has a role in calcium
and sodium homeostasis. J Biol Chem 284:525–533
Quarmby LM (1996) Ca2þ influx activated by low pH in Chlamydomonas. J Gen Physiol
108:351–361
Quarmby LM (2004) Cellular deflagellation. Int Rev Cytol 233(233):47–91
Quarmby LM, Hartzell HC (1994) Two distinct, calcium-mediated, signal transduction pathways
can trigger deflagellation in Chlamydomonas reinhardtii. J Cell Biol 124:807–815
Quarmby LM, Yueh YG, Cheshire JL, Keller LR, Snell WJ, Crain RC (1992) Inositol phospholipid-
metabolism may trigger flagellar excision in Chlamydomonas reinhardtii. J Cell Biol 116:737–744
Rasi MQ, Parker JD, Feldman JL, Marshall WF, Quarmby LM (2009) Katanin knockdown
supports a role for microtubule severing in release of basal bodies before mitosis in
Chlamydomonas. Mol Biol Cell 20:379–388
Ruiz FA, Marchesini N, Seufferheld M, Govindjee D, R. (2001) The polyphosphate bodies of
Chlamydomonas reinhardtii possess a proton-pumping pyrophosphatase and are similar to
acidocalcisomes. J Biol Chem 276:46196–46203
Sakato M, Sakakibara H, King SM (2007) Chlamydomonas outer arm dynein alters conformation
in response to Ca2þ. Mol Biol Cell 18:3620–3634
Saotome M, Safiulina D, Szabadkai G, Das S, Fransson A, Aspenstrom P, Rizzuto R, Hajnoczky G
(2008) Bidirectional Ca2þ-dependent control of mitochondrial dynamics by the Miro GTPase.
Schneider F, Gradmann D, Hegemann P (2013) Ion selectivity and competition in channelrhodopsins.
Biophys J 105:91–100
Shih SM, Engel BD, Kocabas F, Bilyard T, Gennerich A, Marshall WF, Yildiz A (2013)
Intraflagellar transport drives flagellar surface motility. elife 2:e00744
Sineshchekov OA, Jung KH, Spudich JL (2002) Two rhodopsins mediate phototaxis to low- and
high-intensity light in Chlamydomonas reinhardtii. Proc Natl Acad Sci U S A 99:8689–8694
Sjoblad RD, Frederikse PH (1981) Chemotactic responses of Chlamydomonas reinhardtii. Mol
Cell Biol 1:1057–1060
Smith EF (2002) Regulation of flagellar dynein by calcium and a role for an axonemal calmodulin
and calmodulin-dependent kinase. Mol Biol Cell 13:3303–3313
Swarbreck SM, Colaco R, Davies JM (2013) Plant calcium-permeable channels. Plant Physiol
163:514–522
Takahashi K, Isobe M, Knight MR, Trewavas AJ, Muto S (1997) Hypoosmotic shock induces
increases in cytosolic Ca2þ in tobacco suspension-culture cells. Plant Physiol 113:587–594
Terashima M, Petroutsos D, Hudig M, Tolstygina I, Trompelt K, Gabelein P, Fufezan C, Kudla J,
Weinl S, Finazzi G et al (2012) Calcium-dependent regulation of cyclic photosynthetic electron
transfer by a CAS, ANR1, and PGRL1 complex. Proc Natl Acad Sci U S A 109:17717–17722
Thompson SE, Callow JA, Callow ME, Wheeler GL, Taylor AR, Brownlee C (2007) Membrane
recycling and calcium dynamics during settlement and adhesion of zoospores of the green alga
Ulva linza. Plant Cell Environ 30:733–744
Tuxhorn J, Daise T, Dentler WL (1998) Regulation of flagellar length in Chlamydomonas. Cell
Motil Cytoskeleton 40:133–146
Verret F, Wheeler G, Taylor AR, Farnham G, Brownlee C (2010) Calcium channels in photosynthetic
eukaryotes: implications for evolution of calcium-based signalling. New Phytol 187:23–43
Wakabayashi K, Ide T, Kamiya R (2009) Calcium-dependent flagellar motility activation in

Chlamydomonas reinhardtii in response to mechanical agitation. Cell Motil Cytoskeleton
66:736–742
Wang Q, Snell WJ (2003) Flagellar adhesion between mating type plus and mating type minus
gametes activates a flagellar protein-tyrosine kinase during fertilization in Chlamydomonas.
J Biol Chem 278:32936–32942
Weinl S, Held K, Schlucking K, Steinhorst L, Kuhlgert S, Hippler M, Kudla J (2008) A plastid
protein crucial for Ca2þ-regulated stomatal responses. New Phytol 179:675–686
Wheeler GL, Brownlee C (2008) Ca2þ signalling in plants and green algae - changing channels.
Trends Plant Sci 13:506–514
Wheeler GL, Joint I, Brownlee C (2008) Rapid spatiotemporal patterning of cytosolic Ca2þ
underlies flagellar excision in Chlamydomonas reinhardtii. Plant J 53:401–413
Yoshimura K (1996) A novel type of mechanoreception by the flagella of Chlamydomonas. J Exp
Biol 199:295–302
Yoshimura K, Matsuo Y, Kamiya R (2003) Gravitaxis in Chlamydomonas reinhardtii studied with
novel mutants. Plant Cell Physiol 44:1112–1118
Zhu X, Dunand C, Snedden W, Galaud JP (2015) CaM and CML emergence in the green lineage.
Trends Plant Sci 20:483–489
Chlamydomonas: The Eyespot
Mark D. Thompson, Telsa M. Mittelmeier, and Carol L. Dieckmann
Abstract Vision evolved in motile, single-celled, green algae to enhance photo-

synthetic capability. A specialized structure within the cell, the eyespot, aids in the
detection of light direction and is key to improving the efficiency of phototactic
behavior. The Chlamydomonas reinhardtii eyespot is the most well-studied photo-
receptive structure guiding cellular movement. Crucial features required for func-
tion as a light-sensing organelle and signal transducer affecting swimming behavior
are (1) a light-signal transduction cascade, i.e., photon capture, membrane depolar-
ization, and flagellar waveform change; (2) a structure that allows discernment of
light direction, i.e., the elaborate layered membrane organization of the eyespot;
and (3) precise placement of the organelle relative to the flagella, required for
coupling the space/time of light reception to the space/time of the flagellar response
accurately. Here we summarize what is known about eyespot function, assembly
and placement, and highlight the development of new tools and approaches that will
aid in illuminating Chlamydomonas eyespot structure and function.
1 Introduction
Vision evolved in motile, single-celled, green algae to enhance photosynthetic

capability. Rhodopsin proteins inherited from prokaryotic ancestors absorb photons
and change conformation, triggering downstream signaling events that direct
swimming to locations optimal for photosynthesis. Phototaxis, or moving in
response to light, is a complex behavior that requires many cellular components
in addition to the rhodopsin photoreceptors. The cell must be able to crawl or swim.
And, it must be able to discern the location of the light source and link motility
behavior to that information. A specialized structure within the cell, the eyespot,
Experimental work in the Dieckmann lab was supported by NSF award MCB-1157795 (M.T.,
T.M. and C.D.) and NIH award T32 GM008659 (M.T.).
M.D. Thompson • T.M. Mittelmeier • C.L. Dieckmann (*)

Department of Molecular and Cellular Biology, University of Arizona,
Tucson, AZ 85721, USA

258 M.D. Thompson et al.
flagella
eyespot
Fig. 1 Chlamydomonas eyespot. Composite color micrograph and diagram highlighting the
position of the eyespot relative to the flagella. The orange eyespot is visible on the background
of the large, green, cup-shaped chloroplast. The paired flagella, patterned by the basal bodies (light
gray in diagram), emanate from the apical pole of the cell. The pyrenoid (light green circle)
defines the posterior pole
aids in the detection of light direction and is key to improving the efficiency of
phototactic behavior.
Many species of algae have eyespots, organelles that have evolved to organize
photoreceptors together with other components that enhance directional light
reception. Eyespots are likely to have arisen in different lineages independently
(Kivic and Walne 1983), but most share the ability to block light from one or more
directions in the cell, thereby enhancing detection from a particular direction
relative to the cell. The Chlamydomonas reinhardtii eyespot is the most well-
studied photoreceptive structure guiding cellular movement.
The eyespot is readily apparent by light microscopy as an orange oval within the
single, green Chlamydomonas cell (Fig. 1). The approximately 1 μm spot is located
at the “equator” of the cell, roughly halfway between the anterior flagellar pole and
the posterior pole, defined by the pyrenoid, which stores starch in the chloroplast.
The eyespot appears to be associated with the plasma membrane on the outer
surface of the cell. Its role in light detection was first verified by Hartshorne
(1953), who collected an eyeless mutant strain (eye1) that could not phototax.
Subsequent studies with additional eye1 strains confirmed that the eyespot is
required for accurate phototactic behavior (Morel-Laurens and Feinleib 1983;
Foster et al. 1984).
Collectively, data gathered over several decades by many different researchers
has led to a better understanding of Chlamydomonas eyespot structure and function
[reviewed in: Foster and Smyth (1980), Witman (1993), Kreimer (1994), Hegemann
(1997), Sineshchekov and Govorunova (2001), Nagel et al. (2005) and Kreimer
(2009)]. Crucial features required for function as a light-sensing organelle and signal
Chlamydomonas: The Eyespot 259
transducer affecting swimming behavior are (1) a light-signal transduction cascade,

i.e., photon capture, membrane depolarization, and flagellar waveform change; (2) a
cellular structure that allows discernment of light direction, i.e., the elaborate
layered membrane organization of the eyespot; and (3) precise placement of the
organelle relative to the flagella, required for coupling the space/time of light
reception to the space/time of the flagellar response accurately. Each of these three
features will be the focus of a separate section below.
2 Light-Signal Transduction Cascade
Rhodopsin photoreceptors in the eyespot absorb light over a broad range of wave-
lengths, with maxima in the blue-aqua-green part of the spectrum. Two different
proteins with overlapping absorbance spectra, ChR1 and ChR2, govern the photo-
tactic behavior of Chlamydomonas cells (Nagel et al. 2002, 2003; Sineshchekov
et al. 2002). These rhodopsin family proteins with seven transmembrane domains
are most similar to prokaryotic rhodopsins and form ion channels. Absorption of a
photon by the retinal cofactor leads to a conformational change in the opsin, which
opens the ion channel and depolarizes the membrane. Thus, the Chlamydomonas
receptors, which are cation channels, have been named “channelrhodopsins.” Other
names for the ChR1 and ChR2 photoreceptors are CsrA and CsrB (Sineshchekov
et al. 2002) and Acop-1 and Acop-2 (Suzuki et al. 2003). Innovative work has led to
the extensive use of ChR2 for specific control of neurons and other cells in a variety
of animals (Boyden et al. 2005). Presently, multiple such channelrhodopsins are
available, tuned to different wavelengths of light (Wietek and Prigge 2016).
“Optogenetic” control of animal behavior is the most dramatic use of these light-
activated Chlamydomonas plasma membrane ion channels.
Membrane depolarization can be detected at the eyespot after light exposure,
moving in a wave along the membrane of the cell and flagella (Harz and Hegemann
1991). Details of the ion fluxes at the eyespot and flagella have been analyzed by
pipette recording under a variety of conditions (Holland et al. 1996; Nonnengässer
et al. 1996). In response to membrane depolarization, high-speed video microscopy
has revealed that the primarily symmetric breaststroke beating of the two flagella
becomes temporarily asymmetric (Rüffer and Nultsch 1985, 1987). One of the two
flagella takes less robust strokes, while the other takes more robust strokes. This
uneven pulling turns the cell such that it reorients and swims toward the light
(Fig. 2, top row). The differential waveform responses of the two flagella were
observed also using demembranated models of flagella and manipulation of the
calcium ion concentration (Kamiya and Witman 1984). Depolarization and the
change in calcium ion concentration ultimately lead to a change in the complex
breaststroke waveform of the Chlamydomonas flagella, likely due to the differential
response of the inner arm dynein motors along the length of the flagella (Horst and
Witman 1993; Rüffer and Nultsch 1997; King and Dutcher 1997; Okita et al. 2005).
Are there three different states for a flagellum during phototaxis: normal stroking,
Fig. 2 Responses to light. Three cell cartoons in each row represent a time series from left to right.
Initially the cell is breaststroking forward (up). When the light is turned on (arrow on left), the cell
turns toward the light (þptx ¼ positive phototaxis). In stronger light (second row), the cell turns
away from the light (ptx ¼ negative phototaxis). In very bright light (third row), the flagella
switch from breaststroking to an undulating waveform (photoshock), which pushes the cell
backward (down) for a half second, then they resume breaststroking in a randomly chosen
direction
overstroking, and understroking, sampled by switching? Or, is flagellar stroking on

a continuum governed by some kind of amplitude scalar?
The swimming pattern of Chlamydomonas cells is more complicated than can be
described by “breaststroke.” When the photoreceptors are not activated, such as in
the dark or in red light, the flagella pull the cells forward. However, the strokes of
the two flagella are not exact mirror images of one another. The flagellum templated
by the older (mother) basal body has a slightly off-plane stroke that causes the cell
to spiral slowly at two revolutions for every 60 strokes per second (Rüffer and
Nultsch 1987; Fig. 3). The spiral path means that the eyespot, on only one side of
the cell, samples the environment in any particular direction twice per second.
Though they appear equivalent, there must be an inherent difference between the
flagellum templated by the mother versus the daughter basal body that is respon-
sible for this refinement in the breaststroke waveform.
Another refinement of the phototactic response is observed when cells are
exposed to light of different intensities. Photosynthetic membranes can be damaged
by light that is too bright, because the light-harvesting and protective pigment
molecules are overwhelmed and free radicals are generated that damage proteins
and lipids in the membranes (Schuster et al. 1986). When exposed to light inten-
sities that could damage the membranes, Chlamydomonas cells swim away from
light instead of toward it (Fig. 2, middle row). How does this switch in the flagellar
response happen? Instead of the mother flagellum overstroking and the daughter
understroking as for positive phototaxis, the daughter overstrokes and the mother
understrokes. Thus, both flagella can over- or understroke and are not hardwired for
one or the other response. Cells exposed to very bright flashes of light exhibit yet
another behavior, called the “photophobic” response, in which both flagella lose
their breaststroke waveform completely and beat much more similarly to other
motile eukaryotic flagella, in an undulation pattern that propels the cell “backward”
for a half second (Fig. 2, bottom row). Then, the cell resumes breaststroking
forward (Ringo 1967). The “sign” of phototaxis (positive vs. negative) can be
switched by manipulating free radical levels (Wakabayashi et al. 2011) or expres-
sion of functional domains of the blue-light receptor, phototropin (Trippens et al.
2012), but the mechanisms governing switching and photophobic behavior are still
a mystery.
3 Eyespot Structure and Function
Why did carotenoid-pigmented eyespots evolve in green algae? Many different

types of experiments have been done over the years to understand why eyespots
arose. A strong consensus is that they enhance the ability to detect light direction.
Light is directional, i.e., it comes from a source: the sun, a lightning bolt, a fire, a
light bulb, or a laser. Motile photosynthetic algae have an advantage if they can
adjust their location relative to the sun to optimize photosynthesis, while minimiz-
ing damage to the thylakoid membranes. So, how does the eyespot help with
detection of light direction?
Fig. 3 Chlamydomonas
swims in spiral path.
Chlamydomonas flagella
breaststroke in almost a flat
plane relative to each other.
However, the trans
flagellum, on the side away
from the eyespot, beats just
slightly out of the plane,
causing the cell to rotate as
it strokes forward. The cell
rotates approximately twice
per second, while the
flagella beat about 60 times
and move the cell forward
100–200 μm
The Chlamydomonas eyespot is on/near the surface of the cell. Light shining on
the outer surface of the eyespot activates the light-signal transduction cascade
governing phototaxis. Light shining on the other side of the cell, and/or through
the cell, is absorbed efficiently by the elaborate layered structure of the eyespot, and
the cascade is not activated. These observations suggest that the eyespot structure is
“sided” and that the plasma membrane side is different from the side toward the
cell. Electron microscopy first revealed the complexity of the eyespot structure and
the involvement of chloroplast membranes, though the orange eyespot had been
observed against the green background of the large cup-shaped chloroplast many
years before by light microscopy. As shown in the cryo-EM micrograph (Fig. 4) and
3D reconstruction (Fig. 5), the plasma membrane and both chloroplast envelopes
are tightly apposed in the region of the eyespot (Engel et al. 2015). Underlying the
inner envelope are rows of carotenoid-filled pigment granules, with each row
subtended by a thylakoid. In 1980, Foster and Smyth hypothesized that this periodic
arrangement of granules and membranes acted as a quarter-wave plate, absorbing
photons traveling through the cell and striking the layers from the “back” and
reflecting photons striking the eyespot surface from the outside back toward the
Fig. 4 Cryo-EM section of

the eyespot. One section
through the eyespot,
showing the layered
structure. Part (b) is an
enlargement of a small area
of Part (a); the white arrows
are in approximately the
same location in the
micrographs and point to a
row of ordered particles just
under the plasma
membrane. Reprinted with
permission from Ben Engel
(Engel et al. 2015)
Fig. 5 3D reconstruction of
cryo-EM sections through
the eyespot. The outside of
the cell is on the right. False
colors were used to
distinguish the separate
parts of the eyespot
structure. Moving leftward
through the layers: the outer
gray ribbon is part of the
cell wall. The purple and
pink “bubbles” between the
wall and the plasma
membrane were found only
at the eyespot but are of
unknown function. The
inner gray ribbon is the
plasma membrane. The
bright blue structures just
under the plasma membrane
in the top right are
microtubules, presumably
in the D4 rootlet. The light
blue membranes are the
chloroplast outer and inner
envelopes. The pigment
granules are various shades
of orange, and the
thylakoids are green.
Reprinted with permission
from Ben Engel (Engel et al.
2015)
photoreceptors. Both the abilities of the eyespot to block light from the back (Ueki
et al. 2016; Matsunaga et al. 2003) and to reflect light from the outside (Kreimer and
Melkonian 1990) have been demonstrated experimentally, lending credence to the
quarter-wave plate explanation for how this organelle functions. In recent years,
immunofluorescence microscopy has revealed much about the fine structure and
function of the eyespot.
The channelrhodopsins are localized in the plasma membrane, positioned to
capture photons as they first strike the surface of the cell over the eyespot or
secondarily after reflection by the chloroplast layers (Berthold et al. 2008;
Mittelmeier et al. 2013). These molecules may be what was visualized long ago
by freeze-fracture as the major protein entities in the membranes of the eyespot
(Melkonian and Robenek 1980). In 2002–2003, three research groups searched the
Fig. 6 ChR1
photoreceptors are on the
outer surface of the D4
microtubule rootlet.
Fluorescence micrograph of
a Chlamydomonas cell
taken with a structured
illumination microscope.
Acetylated tubulin
monoclonal (green)
highlights the flagella and
four microtubule rootlets.
Channelrhodopsin
1 staining (red) is apparent
along the outer surface of
the D4 microtubule rootlet
and aggregated at the
eyespot
recently available cDNA databases for rhodopsin-like molecules and found cDNAs
for ChR1 and ChR2 (Nagel et al. 2002, 2003; Sineshchekov et al. 2002; Suzuki
et al. 2003). Knockdown analyses showed that they function redundantly for the
most part vis-a-vis phototaxis and photoshock (Sineshchekov et al. 2002, 2009;
Govorunova et al. 2004). Antisera specific to each channelrhodopsin were raised
and have shown that both proteins are restricted to the plasma membrane of the
eyespot (Berthold et al. 2008; Mittelmeier et al. 2013), with small accumulations of
ChR1 apparent in pools near the basal bodies and in a stripe on one of the four major
microtubule rootlet bundles in the cell body (Mittelmeier et al. 2011, Fig. 6).
What do we know about the specific protein and lipid composition of the
eyespot, other than the photoreceptor opsins in the plasma membrane? Two
major approaches have been employed to learn about eyespot proteins. A forward
genetics approach has yielded a few candidates (Lamb et al. 1999), and a mass
spectrometry approach has yielded many more (Schmidt et al. 2006; Wagner et al.
2008; Eitzinger et al. 2015). Here, we have organized what is known about
individual eyespot proteins by “layer,” based on the experimentally determined or
inferred localization of each component.
4 Plasma Membrane Eyespot Proteins
In addition to the genes encoding ChR1 and ChR2 (COP3 and COP4, respectively),
six other opsin genes have been identified in the Chlamydomonas genome
(Kateriya et al. 2004, Awasthi et al. 2016). COP1 and COP2, products of the
same gene by alternative splicing, are abundant and localized at the eyespot, but
do not function as light receptors for phototaxis (Deininger et al. 1995; Fuhrmann
et al. 2001). COP2 was found to co-purify with a factor important for photosystem I
assembly, Ycf4, and reducing levels of COP2 to 10% of wild type resulted in
destabilization of the Ycf4 complex (Ozawa et al. 2009). Perhaps this light receptor
governs the assembly of the photosystem (Ozawa et al. 2009; Kreimer 2009).
HKR1/COP5, COP6, COP7, and COP8 have the characteristic opsin membrane
helices and in addition have histidine kinase domains hypothesized to function in
signal transduction cascades as they do in other “two-component” systems
(Kateriya et al. 2004; Luck et al. 2012, Awasthi et al. 2016). HKR1 has been
localized to the eyespot by immunofluorescence microscopy (Luck et al. 2012), and
COP8 to flagella and the eyespot (Awasthi et al. 2016). Phototropin, which func-
tions in blue-light signal transduction, is found in plasma membrane, axonemal, and
soluble fractions. At the eyespot, phototropin is likely localized to the plasma
membrane and governs the size of the organelle with respect to light fluence; in
high light, the eyespot becomes smaller, and in low light, the eyespot becomes
larger. And, though levels of ChR1 are decreased in high light, eyespot size
determination is not dependent on ChR1, because a Δcop3 mutant has wild-type
eyespot size (Trippens et al. 2012). Phototropin must stimulate/inhibit as yet
unknown crucial regulators of eyespot assembly to affect the size changes relative
to environmental light levels.
Individual mutant strains that could not phototax were collected and screened for
eyespot defects by light microscopy (Lamb et al. 1999). Mutations in the MIN1
gene, on chromosome XII, were identified in strains with miniature eyespots.
Electron microscopy revealed that the min1 mutant strain had disorganized eye-
spots. When grown on minimal medium, the pigment granule layers were found
“floating” in the stroma of the chloroplast, rather than tightly apposed to the
envelope and plasma membrane layers. MIN1 is predicted to be a membrane-
spanning protein lacking a chloroplast-targeting signal (Fig. 7). The polypeptide
has an N-terminal C2 domain, recognized in other proteins as important for
interaction with phospholipid bilayers. In transfection experiments with the large
cells of the moss Physcomitrella, a MIN1 C2 domain-YFP fusion protein associated
Fig. 7 MIN1 and EYE2 both have transmembrane and LysM domains. Two eyespot proteins,
MIN1 and EYE2, both have transmembrane domains (TM) and LysM domains. MIN1 has a C2
domain thought to be important for membrane adhesion and a low complexity region rich in
alanine residues. EYE2 has a chloroplast-targeting sequence (Chl) and a thioredoxin-family active
site domain (Trx)
with the outer chloroplast envelope (Mittelmeier et al. 2008). Mutation of two
conserved aspartate residues to alanine in the C2 domain, thought to coordinate
calcium ions important for recognition, abolished the association of the fusion
protein with the chloroplast envelope. Collectively, the following features suggest
that MIN1 is required for adhesion of the chloroplast components to the outer layers
and resides either in the outer chloroplast envelope or the plasma membrane: the
disorganized eyespot phenotype of the min1 mutant strain, the presence of a
membrane-interacting domain and a membrane-spanning helix in MIN1, lower
levels of photoreceptors in the min1 mutant strain, and lack of a chloroplast-
targeting sequence. Verification of this hypothesis awaits the development of
MIN1-specific antibodies.
The MIN1 C-terminal domain belongs to the LysM family, the most extensively
characterized eukaryotic members of which are found extracellularly and are
involved in recognition between plant roots and nitrogen-fixing bacteria (reviewed
in Greeff et al. 2012). The domain has been shown to bind directly to chitin and
peptidoglycan in cell walls (Gust 2015), which usually are not found intracellularly,
nor at all in Chlamydomonas (Woessner and Goodenough 1994). Interestingly,
many such LysM domains are found in Chlamydomonas proteins, particularly
several in the eyespot proteome (Schmidt et al. 2006; Wagner et al. 2008; Eitzinger
et al. 2015; Table 1). Have these domains been co-opted to function in adhesion
between layers in the Chlamydomonas eyespot?
Table 1 Chlamydomonas proteins containing LysM domains

Chlamydomonas proteins containing LysM domains
Gene name/alias Phytozome v. 11 Cre# In eyespot proteome
LMR2 Cre03.g175351
g4985.t1 Cre04.g227800
g7058.t1 Cre06.g304913
AKC2 Cre06.g307100
g8874.t1 Cre08.g376740
LMR1 Cre09.g393765 X
CEP9 Cre09.g404250
CEP10 Cre10.g456950
MIN1 Cre12.g490700 X
EYE2 Cre12.g509250 X
g14687.t1 Cre14.g609202
PLP8, PLAP8 Cre14.g611700 X
g14905.t1 Cre14.g618641
ELG36 Cre14.g619850
CEP13, SRR29 Cre14.g631100
CEP14 Cre14.g631150
LMR3 Cre16.g667100
CEP16 Cre17.g697300
CEP17 Cre17.g736100
g18125.t1 Cre19.g750397
5 Chloroplast Envelope Protein
An eyeless strain from the phototaxis mutant screen, eye2, also has a mutation in a
gene on chromosome XII, about a million base pairs from MIN1 (Phytozome
v11.0). The EYE2 protein has a chloroplast-targeting signal and, by immunofluo-
rescence microscopy, appears to reside in one of the chloroplast envelopes (Boyd
et al. 2011b). It has an interesting combination of recognizable domains (Fig. 7).
One small domain in the middle of the polypeptide fits well in the 50 adenylylsulfate
reductase subfamily of thioredoxin superfamily enzymes. These enzymes catalyze
the conversion of adenosine 50 phosphosulfate to sulfite in the cysteine biosynthetic
pathway and are primarily found in the stroma of plant chloroplasts (Davidian and
Kopriva 2010). Why the reductase activity would be required for eyespot biogen-
esis was not readily apparent, and mutating the redox active site cysteines to serines
had no deleterious effect on eyespot formation and phototaxis (Roberts et al. 2001).
Does this domain reside in the Chlamydomonas chloroplast stroma, or another
compartment? Localization and orientation in one of two chloroplast envelopes of
the eyespot await verification by immuno-electron microscopy. The other recog-
nizable domain in EYE2 is a LysM domain, similar to that in MIN1 and two other
eyespot proteins (Table 1).
6 Pigment Granule Proteins
Another eyeless locus was identified in our original screen, EYE3. The gene
encoding EYE3 resides on chromosome II and thus is not part of the eyespot-
specific cluster on chromosome XII. Rabbit antiserum raised against an EYE3
peptide sequence was used to show that EYE3 is a constituent of eyespot granules
(Boyd et al. 2011b). EYE3 is a Ser-Thr kinase in the ABC1 family (Do et al. 2001),
and though the details have yet to be published (Dieckmann lab), mutation of the
predicted active site Asp residue in the EYE3 kinase domain causes the loss of
eyespot pigment granules, the eye3 eyeless phenotype readily apparent by light
microscopy.
EYE3 is most similar to several kinases found in plastoglobules of Arabidopsis
(Lundquist et al. 2012). By comparing the extensive list of Chlamydomonas
eyespot proteins generated by proteomic analyses (Schmidt et al. 2006; Wagner
et al. 2008; Eitzinger et al. 2015), to the similar list of Arabidopsis plastoglobule
proteins, it is clear that eyespot granules or globules are similar to plastoglobules
and are likely evolutionarily related (Kreimer 2009; Davidi et al. 2014, 2015).
These compartments, bounded by proteins called fibrillins and monolayers of phos-
pholipids, are home to enzymes involved in biosynthesis of hydrophobic molecules
required for photosynthetic and other plant functions, such as tocopherols and
carotenoids.
Recently, Lohscheider et al. (2016) surveyed all available phosphoproteome

data for plastoglobules and found many phospho-sites on the structural fibrillins
that bound the globules. They hypothesize that the Ser-Thr ABC1 kinases may be
responsible for the phosphorylation of these proteins. Perhaps phosphorylation is
required for assembly or stability of the plastoglobule surface, and by analogy, there
could be a similar requirement for eyespot granule assembly/stability.
In addition to the EYE3 serine/threonine kinase, other ABC1 homologues of
unknown function with respect to eyespot formation and/or photosynthesis were
identified in the eyespot proteome and, similar to EYE3, are likely to be constitu-
ents of the eyespot pigment granules. The first identified eukaryotic ABC1 kinase,
and most well studied, is the yeast mitochondrial ubiquinone biosynthetic factor
Coq8, which is required for specific phosphorylation of three enzymes in the
multimeric Coq complex, Coq3, Coq5, and Coq7. Phosphorylation has been
shown to be required for Coq complex assembly and activity (Xie et al. 2011). In
Arabidopsis, the ABC1K1/ABC1K3 complex is required for prenylquinone bio-
synthesis in plastoglobules, likely through phosphorylation of tocopherol cyclase
(reviewed in van Wijk and Kessler 2017). Based on what is known about Coq8 and
the similarity of EYE3 to Arabidopsis plastoglobular ABC1K6, EYE3 kinase
activity may be required for biosynthesis of some type of quinone in the pigment
granules of the Chlamydomonas eyespot, and loss of this activity is deleterious for
eyespot granule formation.
Another interesting eyespot component first identified by proteomics, SOUL3,
binds hemin and was shown to be a constituent of eyespot granules (Schulze et al.
2013). Knockdown of SOUL3 expression led to smaller eyespots, suggesting that
like EYE3, this granule protein is required also for the integrity of granules and/or
the full oval shape of the organelle.
7 Asymmetric Placement of the Eyespot
Chlamydomonas cells appear to be bilaterally symmetric when viewed through the

light microscope, with the symmetry axis running from the apical basal bodies to
the posterior chloroplast structure called the pyrenoid. The single, orange eyespot is
the readily apparent symmetry anomaly (Fig. 1). On closer examination from the
flagellar pole perspective, the eyespot is found offset precisely 45 clockwise from
the plane of flagellar beating (Fig. 8; Rüffer and Nultsch 1985; Holmes and Dutcher
1989). Presumably a product of the evolutionary refinement of the coupling of light
reception to the flagellar response, this position serves the signal transduction
pathway optimally. Chlamydomonas cells rotate twice per second as they swim
forward (Fig. 3), and the elapsed time from photon capture by ChR’s at the eyespot
to a change in the symmetric breaststroke waveform is about 62 ms, matching the
time it takes for an eighth of a revolution or 45 . This puts the paired under- and
overstrokes by the flagella precisely in the position required to swim toward
(or away from) the light.
Fig. 8 Asymmetric
microtubule cytoskeleton
dictates eyespot position.
Major elements of the
microtubule cytoskeleton
are shown in a side view of
a cell (top) and in a
top-down view of the cell
(bottom). The eyespot is
positioned at the equator of
the cell (dark oval), next to
the D4 rootlet, which is
M4 M2 D2
longer than the other three.
The flagellum and rootlets
on the right side of the cell
are “Daughter” structures
(light gray), formed since D4
the last cell division. On the
left side of the cell are
“Mother” structures (dark
gray/black), formed prior to
the last division
M4 D2
FLA FLA
D4
M2
In addition to the eyespot, other cellular structures, which appear to be symmet-

ric by microscopic analysis of interphase cells, are known to be differentiated by
age and composition. For example, the basal bodies differ in age. The mother basal
body in a cell is at least one generation older than the daughter, which matures from
a pro-basal body just before division. As mentioned above, the flagellum templated
by the mother basal body must differ in composition or regulation of the constituent
dyneins responsible for waveform, because the stroke differs slightly from that of
the daughter. Also, only the mother flagellum is assembled in uni1, uni2, and uni3
mutant strains (Huang et al. 1982; Dutcher and Trabuco 1998; Piasecki and Silflow
2009).
Two pairs of microtubule bundles, called rootlets, are associated with the basal
bodies. The mother pair, called the M2 and M4 rootlets, comprise two and four
microtubules, respectively. And, the daughter pair, D2 and D4, first appears during
cell division. Similar to the flagellar microtubules, the microtubules in these four
rootlets are highly acetylated and can be distinguished from other microtubules of
the cell cortex and spindle utilizing an invaluable monoclonal antibody that recog-
nizes the acetylated form of tubulin coupled with immunofluorescence microscopy
(LeDizet and Piperno 1986; Fig. 6).
Holmes and Dutcher (1989) did a beautiful study describing the duplication of
the basal bodies and rootlet apparatus during cell division, orienting the structures
relative to the position of the eyespot. They found that the eyespot was always
associated with the equatorial end of the D4 rootlet. Therefore, though not readily
apparent by light microscopy, the microtubule cytoskeleton is asymmetric in age of
the basal bodies and associated rootlets. Our hypothesis has been that the eyespot
was positioned near the D4 rootlet by “read out” of some unique feature of the
asymmetric cytoskeleton.
Trying to understand how the eyespot is positioned relative to the flagellar plane
became a serious quest when we isolated the mlt1 mutant in our original screen for
eyespot-defective strains (Lamb et al. 1999). The mutant strain had multiple
eyespots, most often two in logarithmically growing cultures. Roughly 40% of
the cells had two eyespots on one side of the cell, and another 40% had an eyespot
on either side of the cell. In both types of cells, the eyespots appeared to be closer to
the anterior pole than wild-type equatorial eyespots. The remainder of the cells in a
culture had zero, one, or more than two eyespots. The percentage of cells with more
than two eyespots increased as the cultures entered into, or remained in, stationary
phase. Single cells from such a culture grow and divide, resulting in a similar
distribution of cells with aberrant phenotypes. Thus, mlt1 mutants are defective in
the control of eyespot number and proper placement in the cell.
One early hypothesis was that perhaps, unlike wild type, mlt1 cells might retain
the “old” eyespot during cell division. This proved not to be the case. As shown in
Fig. 9, the eyespot in a wild-type mother cell disappears as cell division progresses.
Indeed, the plane of division is coincident with the longitude of the eyespot. We
found that eyespots in mlt1 mother cells, regardless of position within the cell, also
disappear at division.
A generous gift of antiserum raised against the ChR1 channelrhodopsin (Peter
Hegemann, Berlin) launched the analysis of specific eyespot proteins relative to the
asymmetric rootlet cytoskeleton by immunofluorescence microscopy. Using a
fluorescence microscope purchased in 1999, we observed photoreceptor at the
eyespot in wild-type and min1 mutant cells (Mittelmeier et al. 2008). This was
the first evidence that photoreceptor molecules were still associated with the D4
rootlet in cells in which the chloroplast pigment granule layers were disorganized as
for min1, or absent as for eye2 and eye3 mutant cells (Boyd et al. 2011b). However,
instead of defining an oval shape of wild-type size, the photoreceptors were seen in
small dots or streaks directly on the D4 rootlet.
Fig. 9 “Old” eyespots AcTub

disappear in early cell
division. Fluorescence
micrograph of a dividing
cell viewed from the apical
pole shows two pairs of
basal bodies (green dots)
have separated into the
daughter cells, retaining the
old two- and four-
membered rootlets (green),
now mother rootlets. New
D4 rootlets have not begun
to grow out to the positions
where ChR1 photoreceptors
will aggregate at the new
eyespots, labeled “e” ChR1
e e
mother basal bodies
Understanding the importance of the D4 to eyespot assembly was enhanced by

the acquisition of a deconvolution microscope. Higher resolution and deconvol-
ution allowed the detection of photoreceptor not only in oval shapes at the eyespot
in wild-type cells, but all along the cortical surface (outside) of the D4 rootlet
(Mittelmeier et al. 2011). In addition, small “pools” or “depots” of photoreceptor
were observed near the apical ends of the four-membered rootlets. Now, images
captured by a superresolution microscope have solidified the impression that photo-
receptor is found on the “outer” surface of the D4, coincident with the plasma
membrane (Fig. 6).
Our current hypothesis, based on the fluorescence microscopy data described
above, is that the channelrhodopsins are inserted into the endoplasmic reticulum
membrane co-translationally. After trafficking through the Golgi stacks, vesicles
travel to the apical “depots” where they fuse with the plasma membrane. From this
location, the large, atypical C-terminal domains of the Chlamydomonas photo-
receptor molecules are captured by kinesin motors near the minus ends of the D4
microtubules and are trafficked along the rootlet, with the canonical rhodopsin
membrane-spanning helices in the N-halves of the molecules embedded in, and
“dragged through,” the plasma membrane. Alternatively, the vesicles may be
trafficked on the microtubules, and fusion with the plasma membrane occurs at
the eyespot. However, it is not clear why vesicles would be restricted to the outside
surface of the rootlet. Another alternative hypothesis is that photoreceptor is not
trafficked on microtubules, but the vesicles fuse with the membrane only over the
D4 rootlet and at the eyespot location. Differentiating among these three hypotheses
awaits development of live cell microscopy to visualize movement of photoreceptor
molecules.
Why do we observe depots of photoreceptor near the minus ends of the D4 and
M4 rootlet, but photoreceptor is only trafficked on, or associated with, the D4
rootlet? A breakthrough in understanding the exclusivity of the D4 for photo-
receptor association came after a successful third attempt to acquire a useful anti-
serum to the MLT1 protein (Mittelmeier et al. 2015). The MLT1 antibodies detect
the protein exclusively on the D4 rootlet, from the minus ends, all along the rootlet
to the apical edge of the eyespot. Most interphase cells have a “tag end” of
acetylated rootlet extending beyond the posterior edge of the eyespot, but this tag
end of the D4 does not have MLT1 deposition. Therefore, the MLT1 protein on the
D4 not only defines the exclusive longitude of the eyespot in the cell needed for
phototaxis but also the latitude of the eyespot near the equator of the cell.
Since MLT1 is only observed on the D4 rootlet, what happens when cell division
begins and the D4 is soon to become an M4? A careful study of cells going through
division showed that as soon as the flagella are resorbed and the new daughter basal
bodies are mature enough to stain with the anti-acetylated monoclonal, the MLT1
protein disappears from the D4 (Mittelmeier et al. 2015). Once the two pairs of
basal bodies separate from each other into the daughter cells, there is a brief period
when only the old rootlets are visible with anti-acetylated tubulin antibody. Once
the new D4 and D2 rootlets begin to emanate from near the daughter basal bodies,
MLT1 polyclonal antibodies detect the protein on the nascent D4 rootlet. Only later
do the daughter rootlets stain with the anti-acetylated monoclonal. Thus, it appears
that MLT1 associates with the D4 simultaneously with the growth of the D4
outward from the daughter basal body just under the plasma membrane and in the
direction of the equator of the cell. Why it does not associate with the D2 rootlet as
well appears to depend on centrin fibers, because in a centrin mutant strain, vfl2,
MLT1 associated with the presumptive D2 as well as the D4 rootlet. Centrin must
either block MLT1 association with the D2 directly via depositions on the apical
portion of the two-membered rootlets (Geimer and Melkonian 2005), or it acts
indirectly by maintaining structural features of the basal body complex that are
critical for excluding the D2.
Is MLT1 needed absolutely for determining longitude and latitude of the eye-
spot? The answer is yes and no or “sort of,” for longitude. Photoreceptor is still
found on four-membered rootlets in mlt1 mutant cells, but appearance at the
eyespot is very delayed after cell division. In wild type, the ChR’s arrive at the
eyespot simultaneously with the appearance of the EYE2 protein in the underlying
chloroplast envelope. In mlt1 cells, EYE2 arrives with wild-type kinetics, but the
ChR’s are delayed, and the apical pools of photoreceptor molecules expand into
huge aggregations. mlt1 mutant cells often have two eyespots on the D4 but just as
many have an eyespot on the M4 and the D4. Why? Perhaps, photoreceptor
transport is so defective in mlt1 cells that the huge apical pools promote misdirected
trafficking down both four-membered rootlets. And, why the more apical positions
of the eyespots on the D4 and M4? Perhaps with the delay in trafficking, the posi-
tion is fixed more anteriorly. Though photoreceptors/eyespots associate with the D4
rootlet eventually in mlt1 mutant cells, MLT1 must have a key role in promoting
eyespot formation, since eyespots form at the ends of both MLT1-decorated rootlets
in centrin mutant cells (Mittelmeier et al. 2015).
8 Other Latitude Effectors
In addition to MLT1, other genes govern eyespot latitude. A mutation in the PEY1
(posterior eyespot) gene leads to a more posterior placement of the eyespot in the
cell. Immunofluorescence staining of the rootlets showed that the D4 rootlet is
longer in general than in wild-type cells (Boyd et al. 2011a). The cmu1 mutation
also results in much more posterior eyespots and very long cytoplasmic micro-
tubules, including the rootlets (Horst et al. 1999). The genes disrupted by these
mutations have yet to be identified, and thus the mechanism of rootlet lengthening
is unknown. However, the data suggest that the eyespot is more posteriorly posi-
tioned because the D4 is longer.
We could also consider the hypothesis that eyespot position affects the length of
the D4. During wild-type cell division, the D4 rootlet microtubules “grow” toward
the equator of the cell, where the new eyespot forms. The eyespot appears to
become “fixed” at the equator, and for a brief period, the D4 and other rootlets
continue extending to the very posterior pole of the cell. This “long rootlet” stage is
brief and is followed by recession of the plus ends back toward the anterior of the
cell, with the D4 stopping near the posterior edge of the fixed eyespot. Often an
aforementioned “tag end” of the D4 can be seen below the eyespot after recession.
It is our supposition that further recession of the D4 is blocked by the fixed position
of the eyespot. This idea is strengthened by the recession of the other three rootlets
to much more apical positions (Mittelmeier et al. 2011). Thus, one could hypo-
thesize that the latitude of the eyespot and D4 length reflect the relative rates of D4
growth toward the posterior pole, D4 disassembly following the long rootlet stage,
and eyespot fixation.
9 Clustering of Eyespot Loci and Similar Cell Cycle

Expression Profiles
Several of the genes we have identified through forward genetic screens are
located on the left arm of chromosome XII. As shown in Table 2, MIN1, EYE2,
and MLT1 are within one million base pairs of each other, and EYE2 and MLT1 are
only 50 kb apart. Also, the MLT2 locus maps to the region just centromeric of
MLT1. Thus, four of the six loci we have identified are in this region of the
genome. The other two, EYE3 and a third eyeless locus, are within six map units of
each other on the left arm of chromosome II. Why the loci would be clustered is
not immediately apparent, but all are expressed with a similar pattern relative to
the cell cycle as shown in Fig. 10. The expression data plotted here were published
by Zones et al. (2015). New eyespots are assembled shortly after cell division
(Holmes and Dutcher 1989); thus it makes sense that these genes are upregulated
coordinately at the beginning of the dark phase when the cells start to divide.
Though the chromosome XII eyespot genes range over a large section of the left
arm, perhaps there is some local effect on transcription rates in this region with
respect to the cell cycle. However, eyespot loci unlinked to those on XII are also
coordinately upregulated, such as EYE3 and COP4 (ChR2) on II and COP3
(ChR1) on XIV.
Table 2 Locations of genes important for eyespot assembly, placement, and function in the
Chlamydomonas genome
Location on linkage group in
Gene Phytozome v. 11 Cre # Linkage group base pairs Gene size
COP4 cre02.g085257 2 1,623,925 1,631,008 7083
EYE3 cre02.g105600 2 5,183,426 5,189,440 6014
PHOT1 cre03.g199000 3 8,321,420 8,329,663 8243
MIN1 cre12.g490700 12 1,096,696 1,100,777 4081
MLT1 cre12.g509850 12 2,044,806 2,056,067 11,261
EYE2 cre12.g509250 12 2,101,188 2,104,358 3170
COP3 cre14.g611300 14 493,380 500,751 7371
SOUL3 cre16.g666550 16 3,217,434 3,229,838 12,404
1
Value Normalized to Maximum
0.8
0.6
0.4
0.2
0
L
D
5D
5D
5D
D
2L
3L
4L
5L
6L
7L
8L
1D
2D
3D
4D
5D
6D
7D
8D
9D
9L
L
L
L
.5
10
11
12
11
10
12
0.
1.
2.
11
Light/DarkCycle
MLT1 EYE2 EYE3 MIN1 COP3 COP4 SOUL3 PHOT1
Fig. 10 Expression of genes important for eyespot assembly, placement, and function increases
when new eyespots are forming. Changes in expression of Chlamydomonas genes were analyzed
over the cell cycle (Zones et al. 2015). Here the data for the subset of genes encoding proteins
important for eyespot assembly, placement, and function were plotted as a percentage of the
maximum value to reveal the trend of increased expression at cell division, which occurs very
early in the dark phase. The cells were exposed to a 12 h light:12 h dark cycle. Gene expression
was analyzed every hour of light (L) and dark (D), and every half hour during the transition from
light to dark (scale expanded twofold from 11 L to 3D)
10 Future Directions
We predict that our understanding of eyespot biogenesis, placement, and function

will progress rapidly in the near future. One of the exciting recent developments
that will accelerate all research employing Chlamydomonas as an experimental
organism is the availability of insertional mutations in known genes (Li et al. 2016).
Coupling this mutational library with eyespot polypeptides identified by proteomics
(Eitzinger et al. 2015) may lead quickly to new information about the specific
function of individual eyespot proteins and/or provide null strains for the reintro-
duction of tagged protein constructs or proteins with specific site-directed
mutations.
Another continually improving front is the availability of whole-genome
sequencing (Lin and Dutcher 2015). This will be an important complement to the
insertional library, for analyses of nonlethal point mutations in essential genes, as
well as mutations causing more subtle or specific phenotypes in genes for which
knockouts are available.
We salute continuing efforts to develop vectors and other methods to success-
fully avoid the silencing of transgenes in Chlamydomonas, providing reliable
expression of slightly altered native genes, tagged protein constructs for micro-
scopy, or completely foreign genes (Plucinak et al. 2015). These new approaches are
critical for establishing and maintaining strains useful for research on the eyespot
and other cellular structures. They are also great tools for gene knockdown studies.
Extremely exciting are the many continuing advancements in both fluorescence
microscopy and cryoelectron tomography. Absolutely fantastic resolution of the
eyespot in Chlamydomonas promises next-generation tools for analysis of eye-
spot structure and function in wild-type and mutant cells (e.g., Figs. 4 and 5;
Engel et al. 2015).
We plan to continue work on several specific eyespot placement and assembly
problems. One quest is to visualize photoreceptor movement in live cells. Another
is to probe the role of the various domains of the MLT1 protein in exclusive deposi-
tion on D4 rootlet microtubules and not others, stimulation of photoreceptor
localization, and promotion of eyespot assembly. The assembly of the tightly
packed layers of the eyespot is another enigma. Analysis of the LysM domains in
MIN1 and EYE2 and that of the C2 domain in MIN1 are particular targets for
unraveling the specifics of membrane adhesion. Finally, we still do not know the
“master” regulator of eyespot assembly. How is it that EYE2 is localized properly
in the chloroplast envelope “under” the plus ends of the D4 microtubule rootlets,
when photoreceptors are pooled at the apical pole in dividing mlt1 mutant cells?
There must be a protein(s) associated with the plus ends of the D4 microtubules that
signals the proper location for the underlying chloroplast eyespot proteins. We look
forward to making progress on these projects and to learning about other studies
illuminating Chlamydomonas eyespot structure and function.
References
Awasthi M, Ranjan P, Sharma K, Veetil SK, Kateriya S (2016) The trafficking of bacterial type
rhodopsins into the Chlamydomonas eyespot and flagella is IFT mediated. Sci Rep 6:37096
Berthold P, Tsunoda SP, Ernst OP, Mages W, Gradmann D, Hegemann P (2008) Channel-
rhodopsin-1 initiates phototaxis and photophobic responses in Chlamydomonas by immediate
light-induced depolarization. Plant Cell 20:1665–1677
Boyd JS, Gray MM, Thompson MD, Horst CJ, Dieckmann C (2011a) The daughter four-
membered microtubule rootlet determines anterior-posterior positioning of the eyespot in
Chlamydomonas reinhardtii. Cytoskeleton (Hoboken) 68:459–469
Boyd JS, Mittelmeier TM, Lamb MR, Dieckmann C (2011b) Thioredoxin-family protein EYE2
and Ser/Thr kinase EYE3 play interdependent roles in eyespot assembly. Mol Biol Cell 22:
1421–1429
Boyden ES, Zhang F, Bamberg E, Nagel G, Deisseroth K (2005) Millisecond-timescale, geneti-
cally targeted optical control of neural activity. Nat Neurosci 8:1263–1268
Davidi L, Shimoni E, Khozin-Goldberg I, Zamir A, Pick U (2014) Origin of β-carotene-rich
plastoglobuli in Dunaliella bardawil. Plant Physiol 164:2139–2156
Davidi L, Levin Y, Ben-Dor S, Pick U (2015) Proteome analysis of cytoplasmatic and plastidic
β-carotene lipid droplets in Dunaliella bardawil. Plant Physiol 167:60–79
Davidian JC, Kopriva S (2010) Regulation of sulfate uptake and assimilation--the same or not the
same? Mol Plant 3:314–325
Deininger W, Kroger P, Hegemann U, Lottspeich F, Hegemann P (1995) Chlamyrhodopsin

represents a new type of sensory photoreceptor. EMBO J 14:5849–5858
Do TQ, Hsu AY, Jonassen T, Lee PT, Clarke CF (2001) A defect in coenzyme Q biosynthesis is
responsible for the respiratory deficiency in Saccharomyces cerevisiae abc1 mutants. J Biol
Chem 276:18161–18168
Dutcher SK, Trabuco EC (1998) The UNI3 gene is required for assembly of basal bodies of Chla-
mydomonas and encodes delta-tubulin, a new member of the tubulin superfamily. Mol Biol
Cell 9:1293–1308
Eitzinger N, Wagner V, Weisheit W, Geimer S, Boness D, Kreimer G, Mittag M (2015)
Proteomic analysis of a fraction with intact eyespots of Chlamydomonas reinhardtii and
assignment of protein methylation. Front Plant Sci 6:1085
Engel BD, Schaffer M, Kuhn Cuellar L, Villa E, Plitzko JM, Baumeister W (2015) Native archi-
tecture of the Chlamydomonas chloroplast revealed by in situ cryo-electron tomography.
eLife 4:3583
Foster KW, Smyth RD (1980) Light antennas in phototactic algae. Microbiol Rev 44:572–630
Foster KW, Saranak J, Patel N, Zarilli G, Okabe M, Kline T, Nakanishi K (1984) A rhodopsin is
the functional photoreceptor for phototaxis in the unicellular eukaryote Chlamydomonas.
Nature 311:756–759
Fuhrmann M, Stahlberg A, Govorunova E, Rank S, Hegemann P (2001) The abundant retinal
protein of the Chlamydomonas eye is not the photoreceptor for phototaxis and photophobic
responses. J Cell Sci 114:3857–3863
Geimer S, Melkonian M (2005) Centrin scaffold in Chlamydomonas reinhardtii revealed by
immunoelectron microscopy. Eukaryot Cell 4:1253–1263
Govorunova EG, Jung K-H, Sineshchekov OA, Spudich JL (2004) Chlamydomonas sensory rho-
dopsins A and B: cellular content and role in photophobic responses. Biophys J 86: 2342–2349
Greeff C, Roux M, Mundy J, Petersen M (2012) Receptor-like kinase complexes in plant innate
immunity. Front Plant Sci 3:1–7
Gust AA (2015) Peptidoglycan perception in plants. PLoS Pathog 11:e1005275
Hartshorne JN (1953) The function of the eyespot in Chlamydomonas. New Phytol 52:292–297
Harz H, Hegemann P (1991) Rhodopsin-regulated calcium currents in Chlamydomonas.
Nature 351:489–491
Hegemann P (1997) Vision in microalgae. Planta 203:266–274
Holland EM, Braun FJ, Nonnengässer C, Harz H, Hegemann P (1996) The nature of rhodopsin-
triggered photocurrents in Chlamydomonas. I. Kinetics and influence of divalent ions.
Biophys J 70:924–931
Holmes JA, Dutcher SK (1989) Cellular asymmetry in Chlamydomonas reinhardtii. J Cell Sci
94(Pt 2):273–285
Horst CJ, Witman GB (1993) ptx1, a nonphototactic mutant of Chlamydomonas, lacks control of
flagellar dominance. J Cell Biol 120:733–741
Horst CJ, Fishkind DJ, Pazour GJ, Witman GB (1999) An insertional mutant of Chlamydomonas
reinhardtii with defective microtubule positioning. Cell Motil Cytoskeleton 44:143–154
Huang B, Ramanis Z, Dutcher SK, Luck DJ (1982) Uniflagellar mutants of Chlamydomonas:
evidence for the role of basal bodies in transmission of positional information. Cell 29:745–753
Kamiya R, Witman G (1984) Submicromolar levels of calcium control the balance of beating
between the two flagella in demembranated models of Chlamydomonas. J Cell Biol 98:97–107
Kateriya S, Nagel G, Bamberg E, Hegemann P (2004) “Vision” in single-celled algae.
News Physiol Sci 19:133–137
King SJ, Dutcher SK (1997) Phosphoregulation of an inner dynein arm complex in Chlamydo-
monas reinhardtii is altered in phototactic mutant strains. J Cell Biol 136:177–191
Kivic PA, Walne PL (1983) Algal photosensory apparatus probably represent multiple parallel
evolutions. Biosystems 16:31–38
Kreimer G (1994) Cell biology of phototaxis in flagellate algae. Int Rev Cytol 148:229–310
Kreimer G (2009) The green algal eyespot apparatus: a primordial visual system and more?
Curr Genet 55:19–43
Kreimer G, Melkonian M (1990) Reflection confocal laser scanning microscopy of eyespots in
flagellated green algae. Eur J Cell Biol 53:101–111
Lamb MR, Dutcher SK, Worley CK, Dieckmann C (1999) Eyespot-assembly mutants in Chla-
mydomonas reinhardtii. Genetics 153:721–729
LeDizet M, Piperno G (1986) Cytoplasmic microtubules containing acetylated alpha-tubulin in
Chlamydomonas reinhardtii: spatial arrangement and properties. J Cell Biol 103:13–22
Li X, Zhang R, Patena W, Gang SS, Blum SR, Ivanova N, Yue R, Robertson JM, Lefebvre PA,
enables reverse genetics studies of biological processes in Chlamydomonas reinhardtii.
Lin H, Dutcher SK (2015) Genetic and genomic approaches to identify genes involved in flagellar
assembly in Chlamydomonas reinhardtii. Methods Cell Biol 127:349–386
Lohscheider JN, Friso G, van Wijk KJ (2016) Phosphorylation of plastoglobular proteins in
Arabidopsis thaliana. J Exp Bot 67(13):3975–3984. doi:10.1093/jxb/erw091
Luck M, Mathes T, Bruun S, Fudim R, Hagedorn R, Tran Nguyen TM, Kateriya S, Kennis JTM,
Hildebrandt P, Hegemann P (2012) A photochromic histidine kinase rhodopsin (HKR1) that is
bimodally switched by ultraviolet and blue light. J Biol Chem 287:40083–40090
Lundquist PK, Davis JI, van Wijk KJ (2012) ABC1K atypical kinases in plants: filling the orga-
nellar kinase void. Trends Plant Sci 17:546–555
Matsunaga S, Watanabe S, Sakaushi S, Miyamura S, Hori T (2003) Screening effect diverts the
swimming directions from diaphototactic to positive phototactic in a disk-shaped green flagel-
late Mesostigma viride. Photochem Photobiol 77:324–329
Melkonian M, Robenek H (1980) Eyespot membranes of Chlamydomonas reinhardii: a freeze-
fracture study. J Ultrastruct Res 72:90–102
Mittelmeier TM, Berthold P, Danon A, Lamb MR, Levitan A, Rice ME, Dieckmann C (2008)
C2 domain protein MIN1 promotes eyespot organization in Chlamydomonas reinhardtii.
Mittelmeier TM, Dieckmann C, Boyd JS, Lamb MR (2011) Asymmetric properties of the Chla-
mydomonas reinhardtii cytoskeleton direct rhodopsin photoreceptor localization. J Cell Biol
193:741–753
Mittelmeier TM, Thompson MD, Oztürk E, Dieckmann C (2013) Independent localization of
plasma membrane and chloroplast components during eyespot assembly. Eukaryot Cell 12:
1258–1270
Mittelmeier TM, Thompson MD, Lamb MR, Lin H, Dieckmann C (2015) MLT1 links cytoskeletal
asymmetry to organelle placement in Chlamydomonas. Cytoskeleton 72:1–11
Morel-Laurens N, Feinleib ME (1983) Photomovement in an “eyeless” mutant of Chlamydo-
monas. Photochem Photobiol 37:189–194
Nagel G, Ollig D, Fuhrmann M, Kateriya S, Musti AM, Bamberg E, Hegemann P (2002)
Channelrhodopsin-1: a light-gated proton channel in green algae. Science 296:2395–2398
Nagel G, Szellas T, Huhn W, Kateriya S, Adeishvili N, Berthold P, Ollig D, Hegemann P,
Bamberg E (2003) Channelrhodopsin-2, a directly light-gated cation-selective membrane
channel. Proc Natl Acad Sci U S A 100:13940–13945
Nagel G, Szellas T, Kateriya S, Adeishvili N, Hegemann P, Bamberg E (2005)
Channelrhodopsins: directly light-gated cation channels. Biochem Soc Trans 33:863–866
Nonnengässer C, Holland EM, Harz H, Hegemann P (1996) The nature of rhodopsin-triggered
photocurrents in Chlamydomonas. II. Influence of monovalent ions. Biophys J 70:932–938
Okita N, Isogai N, Hirono M, Kamiya R, Yoshimura K (2005) Phototactic activity in Chlamydo-
monas “non-phototactic” mutants deficient in Ca2þdependent control of flagellar dominance
or in inner-arm dynein. J Cell Sci 118:529–537
Ozawa SI, Nield J, Terao A, Stauber EJ, Hippler M, Koike H, Rochaix JD, Takahashi Y (2009)
Biochemical and structural studies of the large Ycf4-photosystem I assembly complex of the
green alga Chlamydomonas reinhardtii. Plant Cell 21:2424–2442
Piasecki BP, Silflow CD (2009) The UNI1 and UNI2 genes function in the transition of triplet to
doublet microtubules between the centriole and cilium in Chlamydomonas. Mol Biol Cell
20:368–378
Plucinak TM, Horken KM, Jiang W, Fostvedt J, Nguyen ST, Weeks DP (2015) Improved and
versatile viral 2A platforms for dependable and inducible high-level expression of dicistronic
nuclear genes in Chlamydomonas reinhardtii. Plant J 82:717–729
Ringo DL (1967) Flagellar motion and fine structure of the flagellar apparatus in Chlamydomonas.
J Cell Biol 33:543–571
Roberts DG, Lamb MR, Dieckmann C (2001) Characterization of the EYE2 gene required for
eyespot assembly in Chlamydomonas reinhardtii. Genetics 158:1037–1049
Rüffer U, Nultsch W (1985) High-speed cinematographic analysis of the movement of Chlamydo-
monas. Cell Motil Cytoskeleton 5:251–263
Rüffer U, Nultsch W (1987) Comparison of the beating of cis- and trans-flagella of Chlamydo-
monas cells held on micropipettes. Cell Motil Cytoskeleton 7:87–93
Rüffer U, Nultsch W (1997) Flagellar photoresponses of ptx1, a nonphototactic mutant of Chla-
mydomonas. Cell Motil Cytoskeleton 37:111–119
Schmidt M, Gessner G, Luff M, Heiland I, Wagner V, Kaminski M, Geimer S, Eitzinger N,
Reissenweber T, Voytsekh O, Fiedler M, Mittag M, Kreimer G (2006) Proteomic analysis of
the eyespot of Chlamydomonas reinhardtii provides novel insights into its components and
tactic movements. Plant Cell 18:1908–1930
Schulze T, Schreiber S, Iliev D, Boesger J, Trippens J, Kreimer G, Mittag M (2013) The heme-
binding protein SOUL3 of Chlamydomonas reinhardtii influences size and position of the
eyespot. Mol Plant 6:931–944
Schuster G, Dewit M, Staehelin A, Ohad I (1986) Transient inactivation of the thylakoid photo-
system II light-harvesting protein kinase system and concomitant changes in intramembrane
particle size during photoinhibition of Chlamydomonas reinhardtii. J Cell Biol 103:71–80
Sineshchekov OA, Govorunova EG (2001) Rhodopsin receptors of phototaxis in green flagellate
algae. Biochemistry (Mosc) 66:1300–1310
Sineshchekov O, Jung K, Spudich J (2002) Two rhodopsins mediate phototaxis to low- and high-
intensity light in Chlamydomonas reinhardtii. Proc Natl Acad Sci U S A 99:8689–8694
Sineshchekov OA, Govorunova EG, Spudich JL (2009) Photosensory functions of channel-
rhodopsins in native algal cells. Photochem Photobiol 85:556–563
Suzuki T, Yamasaki K, Fujita S, Oda K, Iseki M, Yoshida K, Watanabe M, Daiyasu H, Toh H,
Asamizu E, Tabata S, Miura K, Fukuzawa H, Nakamura S, Takahashi T (2003) Archaeal-type
rhodopsins in Chlamydomonas: model structure and intracellular localization. Biochem Bio-
phys Res Commun 301:711–717
Trippens J, Greiner A, Schellwat J, Neukam M, Rottmann T, Lu Y, Kateriya S, Hegemann P,
Kreimer G (2012) Phototropin influence on eyespot development and regulation of phototactic
behavior in Chlamydomonas reinhardtii. Plant Cell 24:4687–4702
Ueki N, Ide T, Mochiji S, Kobayashi Y, Tokutsu R, Ohnishi N, Yamaguchi K, Shigenobu S,
Tanaka K, Minagawa J, Hisabori T, Hirono M, Wakabayashi K-I (2016) Eyespot-dependent
determination of the phototactic sign in Chlamydomonas reinhardtii. Proc Natl Acad Sci U S A
113:5299–5304
van Wijk KJ, Kessler F (2017) Plastoglobuli: plastid microcompartments with integrated functions
in metabolism, plastid developmental transitions, and environmental adaptation. Annu Rev
Plant Biol 68:253–289
Wakabayashi K, Misawa Y, Mochiji S, Kamiya R (2011) Reduction-oxidation poise regulates the
sign of phototaxis in Chlamydomonas reinhardtii. Proc Natl Acad Sci U S A 108:11280–11284
Wagner V, Ullmann K, Mollwo A, Kaminski M, Mittag M, Kreimer G (2008) The phospho-

proteome of a Chlamydomonas reinhardtii eyespot fraction includes key proteins of the
light signaling pathway. Plant Physiol 146:772–788
Wietek J, Prigge M (2016) Enhancing channelrhodopsins: an overview. Methods Mol Biol 1408:
141–165
Witman GB (1993) Chlamydomonas phototaxis. Trends Cell Biol 3:403–408
Woessner JP, Goodenough UW (1994) Volvocine cell walls and their constituent glycoproteins:
an evolutionary perspective. Protoplasma 181:245–258
Xie LX, Hsieh EJ, Watanabe S, Allan CM, Chen JY, Tran UC, Clarke CF (2011) Expression of the
human atypical kinase ADCK3 rescues coenzyme Q biosynthesis and phosphorylation of
Coq polypeptides in yeast coq8 mutants. Biochim Biophys Acta 1811:348–360
Zones JM, Blaby IK, Merchant SS, Umen JG (2015) High-resolution profiling of a synchronized
diurnal transcriptome from Chlamydomonas reinhardtii reveals continuous cell and metabolic
differentiation. Plant Cell 27:2743–2769

Chlamydomonas Molecular Genetics and Physiology

Uploaded by

Copyright:

Available Formats

Chlamydomonas Molecular Genetics and Physiology

Uploaded by

Document Information

Original Title

Copyright

Available Formats

Share this document

Share or Embed Document

Sharing Options

Did you find this document useful?

Is this content inappropriate?

Copyright:

Available Formats

Chlamydomonas Molecular Genetics and Physiology

Uploaded by

Copyright:

Available Formats

Microbiology Monographs

Series Editor: Alexander Steinbüchel

ISSN 1862-5576 ISSN 1862-5584 (electronic)

Library of Congress Control Number: 2017958132

© Springer International Publishing AG 2017

Printed on acid-free paper

This Springer imprint is published by Springer Nature

Genomics and Functional Genomics in Chlamydomonas reinhardtii . . . . 1

Ian K. Blaby and Crysten E. Blaby-Haas

Abstract The availability of the Chlamydomonas reinhardtii nuclear genome

The first bacterial genome sequence, completed in the mid-1990s (Fleischmann

I.K. Blaby (*) • C.E. Blaby-Haas

© Springer International Publishing AG 2017 1

1.1 What Is Functional Genomics?

genome transcriptome proteome phenome modeling biological function

1.2 What Is Protein Function?

Function is a multifaceted description of a protein’s role in the cell. This description

1.3 The Functional Annotation Problem

Traditionally, functional characterization of proteins has largely been performed

At some point, the genome being automatically annotated is so phylogenetically

1.4 Why Use Functional Genomics?

Each type of functional genomics experiment provides a snapshot of some func-

2 Chlamydomonas reinhardtii Genomics

2.1 The Status of Protein Function Annotation

A wide range of biological phenomena is studied in C. reinhardtii (herein Chla-

Table 1 Gene annotation status in Chlamydomonas

2.2 The Chlamydomonas Nuclear Genome and Gene Models

new computational algorithms and the incorporation of experimental datasets, the

Table 2 History of Chlamydomonas genome assemblies and generations of gene models

determined), were incorporated into an updated Augustus algorithm (Aug11.6) and

2.3 Present and Future Directions for the Chlamydomonas

GUC V 2.32 GCC A 6.12 GAC D 4.21 GGC G 6.29 C

3 Functional Genomics in Chlamydomonas

Here, we define a functional genomics dataset as the cumulative results of a

Transcriptomes offer a valuable tool in the functional genomics arsenal by provid-

To gain a functional genomics insight, differential abundance measurements

For geneticists, a condition-specific phenotype resulting from the disruption of a

Purpose for using

tool (Ding et al. Microalgae/sdcre/ prediction

Purpose for using

3.4 Other “Omics” Experimental Types

3.5 Databases and Resources for Chlamydomonas Genomics

A growing number of online resources are available to curate, disseminate, and

4 Outlook and Future Directions

4.1 Integrative Approaches to Analysis

Since it is unlikely that a single genome-wide technique will definitively enable

the integration of data becomes increasingly powerful, as the likelihood of any

4.2 Comparative Algal Genomics

Recently, two C. reinhardtii genome comparison studies have offered an appreci-

growth requirements, and habitat of the respective organisms as well as by experi-

allows for automated proteogenomic annotation of the Chlamydomonas reinhardtii genome.

Eukaryotic C. reinhardtii microalgae store DNA, the basic chemical compound

J.H. Mussgnug (*)

© Springer International Publishing AG 2017 27

2 Methods for Nuclear DNA Transformation

2.1 Biolistic Transformation

2.2 Agitation of Cells in the Presence of DNA

A disadvantage of the biolistic method is that sample preparation is quite time-

applications, and because of its simplicity, it furthermore represents an ideal choice