Skip to content
New issue

Have a question about this project? Sign up for a free GitHub account to open an issue and contact its maintainers and the community.

Sign up for GitHub

By clicking “Sign up for GitHub”, you agree to our terms of service and privacy statement. We’ll occasionally send you account related emails.

Already on GitHub? Sign in to your account

Jump to bottom

Both ColabFold notebook and localcolabfold cannot predict this sequence. #270

Open
Huilin-Li opened this issue Oct 29, 2024 · 0 comments
Open

Both ColabFold notebook and localcolabfold cannot predict this sequence. #270

Huilin-Li opened this issue Oct 29, 2024 · 0 comments

Comments

@Huilin-Li
Copy link

My sequence is VQTLDEFTIQQMRNFPNATGELSGLLRDIGLAAKRVNVEVNKAGLVDILGDAGSVNVQGEEVKKLDVYANDQFMGVLRHGISCAGIGSEELDDVVIFDDEISNNSKYVCLFDPLDGSANIDVNVSIGTIFSVFRRVTPIGQPATEADFLQAGIRQIAAGYVIYGSSTILVYATRRGVNGFTLDPSIGEWTLSHPDIKCPPTGKIYSVNHGNFFQYDQGVQDYITACQRKDKTNGGPYTQRYIGSMVSDMHRNLIKGGIFMYPGYTGKPGGKLRLMYECNPFAFILEVAGGKATDGKNRILDKVPGHIHDRTPFFAGSKEMMEELETYLPK, which is produced by gene (IMG ID: 3300044540|Ga0451702_0009729|CDS|Ga0451702_0009729_952_1944|+|952:1944) transcription.

Current Behavior

In localcolabfold, I got the followings. I had tested it for many times, and it was always sleeping and PENDING. I had asked it to run all night, but after 11 hours, it was still stuck on sleeping and PENDING.

2024-10-29 17:45:11,843 Query 15/50: aabzA (length 330)
2024-10-29 17:45:13,451 Sleeping for 9s. Reason: PENDING
2024-10-29 17:45:23,584 Sleeping for 6s. Reason: PENDING
2024-10-29 17:45:30,715 Sleeping for 7s. Reason: PENDING
2024-10-29 17:45:38,830 Sleeping for 5s. Reason: PENDING
... ...
2024-10-29 17:48:02,390 Sleeping for 7s. Reason: PENDING
2024-10-29 17:48:10,692 Sleeping for 6s. Reason: PENDING
2024-10-29 17:48:17,870 Sleeping for 8s. Reason: PENDING
2024-10-29 17:48:27,195 Sleeping for 10s. Reason: PENDING
2024-10-29 17:48:38,348 Sleeping for 6s. Reason: PENDING
2024-10-29 17:48:46,016 Sleeping for 5s. Reason: PENDING
2024-10-29 17:48:52,242 Sleeping for 6s. Reason: PENDING
2024-10-29 17:48:59,529 Sleeping for 10s. Reason: PENDING
... ...
2024-10-29 17:51:44,062 Sleeping for 5s. Reason: PENDING
2024-10-29 17:51:50,706 Sleeping for 5s. Reason: PENDING
2024-10-29 17:51:56,885 Sleeping for 8s. Reason: PENDING
2024-10-29 17:52:06,066 Sleeping for 10s. Reason: PENDING
... ...
2024-10-29 18:00:47,716 Sleeping for 9s. Reason: PENDING
2024-10-29 18:00:57,929 Sleeping for 7s. Reason: PENDING
2024-10-29 18:01:06,480 Sleeping for 6s. Reason: PENDING
2024-10-29 18:01:13,658 Sleeping for 6s. Reason: PENDING
2024-10-29 18:01:20,780 Sleeping for 10s. Reason: PENDING
2024-10-29 18:01:32,096 Sleeping for 6s. Reason: PENDING
2024-10-29 18:01:39,422 Sleeping for 8s. Reason: PENDING
... ....
2024-10-29 18:05:16,270 Sleeping for 6s. Reason: PENDING
2024-10-29 18:05:23,511 Sleeping for 9s. Reason: PENDING
2024-10-29 18:05:33,636 Sleeping for 7s. Reason: PENDING
2024-10-29 18:05:41,849 Sleeping for 10s. Reason: PENDING
2024-10-29 18:05:53,029 Sleeping for 7s. Reason: PENDING
2024-10-29 18:06:01,183 Sleeping for 9s. Reason: PENDING
PENDING:   0%|                                                                                                                                                                                                                                                                          | 0/150 [elapsed: 20:49 remaining: ?]

Then, I changed to use ColabFold notebook, but I met the same issue.
image
Sign up for free to join this conversation on GitHub. Already have an account? Sign in to comment
Assignees
No one assigned
Labels
None yet
Projects
None yet
Milestone
No milestone
Development

No branches or pull requests
1 participant
@Huilin-Li