Caution: Please only report your issue related to the installation on your local PC or macOS. If you can get the help message by colabfold_batch --help or run a test prediction successfully, your installation is successful. Requests or questions regarding ColabFold features should be directed to ColabFold repo's issues.

What is your installation issue?

I tried to run colabfold_search in SLURM cluster but it takes like more than 2 days, even though input fasta is just single input.

Computational environment

I used this job allocations:
#SBATCH -c 10 # Requested cores
#SBATCH --time=2-00:00 # Runtime in D-HH:MM format
#SBATCH --partition=medium # Partition to run in
#SBATCH --mem=100GB # Requested Memory
#SBATCH -o %j.out # File to which STDOUT will be written, including job ID (%j)
#SBATCH -e %j.err # File to which STDERR will be written, including job ID (%j)

To Reproduce

And this my colabfold_search execute command:
colabfold_search
--use-env 1
--use-templates 0
--db-load-mode 2
--mmseqs mmseqs
--threads 4
${input_path}
${database_path}
${output_path}

and my fasta input is simply this:

S1_S8
NHIIIPSYASWFDYNCIHVIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLTGDVCAVMRVHAFLEQWGLVNYQVDPESRPMAMGPPPTPHFNVLADTPSGLVPLHLRSPQVPAAQQMLNFPEKNKEKPVDLQNFGLRTDIYSKKTLAKSKGASAGREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYLENSDASLGPLAYQPVPFSQSGNPVMSTVAFLASVVDPRVASAAAKAALEEFSRVREEVPLELVEAHVKKVQEAAR:PLCTLLDWQDSLAKRCVCVSNTIRSLSFVPGNDFEMSKHPGLLLILGKLILLHHKHPERKQAPLTYEKEEEQDQGVSCNKVEWWWDCLEMLRENTLVTLANISGQLDLSPYPESICLPVLDGLLHWAVCPSAEAQDPFSTLGPNAVLSPQRLVLETLSKLSIQDNNVDLILATPPFSRLEKLYSTMVRFLSDRKNPVCREMAVVLLANLAQGDSLAARAIAVQKGSIGNLLGFLEDSLAATQFQQSQASLLHMQNPPFEPTSVDMMRRAARALLALAKVDENHSEFTLYESRLLDISVSPLMNSLVSQVICDVLFLIGQS

Expected behavior

I expected short run time like few hours, but it takes more than 2 days and job was cancelled.
And I attaching the log file, too.
42792350.txt

Thank you for your help in advance!