|
| 1 | +The Protein-Disorder Module of BioJava |
| 2 | +===================================================== |
| 3 | + |
| 4 | +A tutorial for the protein-disorder module of [BioJava](http://www.biojava.org) |
| 5 | + |
| 6 | +## About |
| 7 | +<table> |
| 8 | + <tr> |
| 9 | + <td> |
| 10 | + |
| 11 | + </td> |
| 12 | + <td> |
| 13 | + The <i>protein-disorder module</i> of BioJava provide an API that allows to |
| 14 | + <ul> |
| 15 | + <li>predict protein-disorder using the JRONN algorithm</li> |
| 16 | + </ul> |
| 17 | + |
| 18 | + |
| 19 | + </td> |
| 20 | + </tr> |
| 21 | +</table> |
| 22 | + |
| 23 | +## How can I predict disordered regions on a protein sequence? |
| 24 | +----------------------------------------------------------- |
| 25 | + |
| 26 | +BioJava provide a module *biojava-protein-disorder* for prediction |
| 27 | +disordered regions from a protein sequence. Biojava-protein-disorder |
| 28 | +module for now contains one method for the prediction of disordered |
| 29 | +regions. This method is based on the Java implementation of |
| 30 | +[RONN](http://www.strubi.ox.ac.uk/RONN) predictor. |
| 31 | + |
| 32 | +This code has been originally developed for use with |
| 33 | +[JABAWS](http://www.compbio.dundee.ac.uk/jabaws). We call this code |
| 34 | +*JRONN*. *JRONN* is based on the C implementation of RONN algorithm and |
| 35 | +uses the same model data, therefore gives the same predictions. JRONN |
| 36 | +based on RONN version 3.1 which is still current in time of writing |
| 37 | +(August 2011). Main motivation behind JRONN development was providing an |
| 38 | +implementation of RONN more suitable to use by the automated analysis |
| 39 | +pipelines and web services. Robert Esnouf has kindly allowed us to |
| 40 | +explore the RONN code and share the results with the community. |
| 41 | + |
| 42 | +Original version of RONN is described in [Yang,Z.R., Thomson,R., |
| 43 | +McMeil,P. and Esnouf,R.M. (2005) RONN: the bio-basis function neural |
| 44 | +network technique applied to the detection of natively disordered |
| 45 | +regions in proteins. Bioinformatics 21: |
| 46 | +3369-3376](http://bioinformatics.oxfordjournals.org/content/21/16/3369.full) |
| 47 | + |
| 48 | +Examples of use are provided below. For more information please refer to |
| 49 | +JronnExample testcases. |
| 50 | + |
| 51 | +Finally instead of an API calls you can use a [ command line |
| 52 | +utility](/wikis/BioJava:CookBook3:ProteinDisorderCLI "wikilink"), which is |
| 53 | +likely to give you a better performance as it uses multiple threads to |
| 54 | +perform calculations. |
| 55 | + |
| 56 | +Example 1: Calculate the probability of disorder for every residue in the sequence |
| 57 | +---------------------------------------------------------------------------------- |
| 58 | + |
| 59 | +```java |
| 60 | +FastaSequence fsequence = new FastaSequence("name", |
| 61 | + "LLRGRHLMNGTMIMRPWNFLNDHHFPKFFPHLIEQQAIWLADWWRKKHC" + |
| 62 | + "RPLPTRAPTMDQWDHFALIQKHWTANLWFLTFPFNDKWGWIWFLKDWTPGSADQAQRACTWFFCHGHDTN"); |
| 63 | + |
| 64 | +float[] rawProbabilityScores = Jronn.getDisorderScores(fsequence); |
| 65 | +``` |
| 66 | + |
| 67 | +Example 2: Calculate the probability of disorder for every residue in the sequence for all proteins from the FASTA input file |
| 68 | +----------------------------------------------------------------------------------------------------------------------------- |
| 69 | + |
| 70 | +```java |
| 71 | +final List<FastaSequence> sequences = SequenceUtil.readFasta(new FileInputStream("src/test/resources/fasta.in")); |
| 72 | +Map<FastaSequence, float[]> rawProbabilityScores = Jronn.getDisorderScores(sequences); ``` |
| 73 | + |
| 74 | +Example 3: Get the disordered regions of the protein for a single protein sequence |
| 75 | +---------------------------------------------------------------------------------- |
| 76 | + |
| 77 | +```java |
| 78 | +FastaSequence fsequence = new FastaSequence("Prot1", "LLRGRHLMNGTMIMRPWNFLNDHHFPKFFPHLIEQQAIWLADWWRKKHC" + |
| 79 | + "RPLPTRAPTMDQWDHFALIQKHWTANLWFLTFPFNDKWGWIWFLKDWTPGSADQAQRACTWFFCHGHDTN" + |
| 80 | + "CQIIFEGRNAPERADPMWTGGLNKHIIARGHFFQSNKFHFLERKFCEMAEIERPNFTCRTLDCQKFPWDDP"); |
| 81 | + |
| 82 | +Range[] ranges = Jronn.getDisorder(fsequence); |
| 83 | +``` |
| 84 | + |
| 85 | +Example 4: Calculate the disordered regions for the proteins from FASTA file |
| 86 | +---------------------------------------------------------------------------- |
| 87 | + |
| 88 | +```java |
| 89 | +final List<FastaSequence> sequences = SequenceUtil.readFasta(new FileInputStream("src/test/resources/fasta.in")); |
| 90 | +Map<FastaSequence, Range[]> ranges = Jronn.getDisorder(sequences); |
| 91 | + |
| 92 | +``` |
| 93 | + |
| 94 | + |
| 95 | +### Author: |
| 96 | + |
| 97 | +[Andreas Prlić](https://github.com/andreasprlic) |
| 98 | + |
| 99 | +## Please cite |
| 100 | + |
| 101 | +**BioJava: an open-source framework for bioinformatics in 2012**<br/> |
| 102 | +*Andreas Prlic; Andrew Yates; Spencer E. Bliven; Peter W. Rose; Julius Jacobsen; Peter V. Troshin; Mark Chapman; Jianjiong Gao; Chuan Hock Koh; Sylvain Foisy; Richard Holland; Gediminas Rimsa; Michael L. Heuer; H. Brandstatter-Muller; Philip E. Bourne; Scooter Willis* <br/> |
| 103 | +[Bioinformatics (2012) 28 (20): 2693-2695.](http://bioinformatics.oxfordjournals.org/content/28/20/2693.abstract) <br/> |
| 104 | +[](http://bioinformatics.oxfordjournals.org/content/28/20/2693.abstract) [](http://www.ncbi.nlm.nih.gov/pubmed/22877863) |
| 105 | + |
| 106 | +## License |
| 107 | + |
| 108 | +The content of this tutorial is available under the [CC-BY](http://creativecommons.org/licenses/by/3.0/) license. |
| 109 | + |
| 110 | +[view license](../license.md) |
| 111 | + |
| 112 | + |
| 113 | + |
| 114 | +<!--automatically generated footer--> |
| 115 | + |
| 116 | +--- |
| 117 | + |
| 118 | +Navigation: |
| 119 | +[Home](../README.md) |
| 120 | +| Book 3: The Protein Structure modules |
| 121 | + |
| 122 | +Prev: [Book 4: The Genomics Module](../genomics/README.md) |
0 commit comments